ACL_RS00235


  Uniprot: A9NEA7
Description: transcriptional regulator
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 11,571
Subunit structure [CC]: 
Gene ontology (GO): sequence-specific DNA binding [GO:0043565]
Gene ontology IDs: GO:0043565
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 32 84 HTH cro/C1-type DNA-binding. {ECO:0000259|PROSITE:PS50943}.
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: ABX80687
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 1.10.260.40
InterPro: 
PANTHER: IPR001387;IPR010982
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: PS50943
ProDom: PF01381
SMART: 
SUPFAM: SM00530
TIGRFAMs: SSF47413
56270-56564(+)

>nucleotide sequence
ATGAAAAATAAAAATATGTTTGATATAAGTGACTTTGTTGGTGTCGAAACAATTCAAGTA
GTCAAACATAATTTAATAAATAGATTTAAATTAAGAAGAAAAGAATCTAGAATGACTCAA
AGACTTTTAAGTCAAATGTCTGGTGTTAGCTATGCATCAGTTAGGCGATTTGAGACTTCA
GGAGATATTTCTTTTGCCTCACTTCTAAAGCTAAGTGAAGCACTTGGATTGCTTTTGGAA
TTTAATCAGCTATTTAGTAGACCTATAATTAAGGATATTCGGAGGGGAAAATGA


>protein sequence
MKNKNMFDISDFVGVETIQVVKHNLINRFKLRRKESRMTQRLLSQMSGVSYASVRRFETS
GDISFASLLKLSEALGLLLEFNQLFSRPIIKDIRRGKW






















© Fisunov Lab of Proteomics, 2016.