ACL_RS01100


  Uniprot: A9NER9
Description: hydroxymethylglutaryl-CoA reductase, degradative
EC number: 1.1.1.88
Annotation score: 2 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: CATALYTIC ACTIVITY: (R)-mevalonate + CoA + 2 NAD(+) = 3-hydroxy-3-methylglutaryl-CoA + 2 NADH. {ECO:0000256|RuleBase:RU361219}.
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: PATHWAY: Metabolic intermediate metabolism; (R)-mevalonate degradation; (S)-3-hydroxy-3-methylglutaryl-CoA from (R)-mevalonate: step 1/1. {ECO:0000256|RuleBase:RU361219}.
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 44,506
Subunit structure [CC]: 
Gene ontology (GO): coenzyme binding [GO:0050662]; hydroxymethylglutaryl-CoA reductase (NADPH) activity [GO:0004420]; hydroxymethylglutaryl-CoA reductase activity [GO:0042282]; coenzyme A metabolic process [GO:0015936]
Gene ontology IDs: GO:0004420; GO:0015936; GO:0042282; GO:0050662
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the HMG-CoA reductase family. {ECO:0000256|RuleBase:RU361219}.
Protein families: HMG-CoA reductase family
Coiled coil: 
Domain [FT]: 
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: A9NER9
MEROPS: 
EnsemblBacteria KO: ABX80849
UniPathway: K00054
CDD: 
Gene3D: cd00644
HAMAP: 3.30.70.420;3.90.770.10
InterPro: 
PANTHER: IPR002202;IPR004553;IPR023074;IPR023076;IPR009023;IPR009029
PIRSF: PTHR10572
PRINTS: 
PROSITE: PR00071
Pfam: PS01192;PS50065
ProDom: PF00368
SMART: 
SUPFAM: 
TIGRFAMs: SSF55035;SSF56542
214498-215728(-)

>nucleotide sequence
TTATGACAGGGTCTTTATAAATTCTTTGGCGTTTGCCACTGTAATTTCTTTACTAGTGAC
TAAATGGTTTACAACTTCATTAATGTTTGAAGGTTGTGCACCAGCTTCAAGTGCAACGTT
TCTTGCATGTAATCTCATATGACCTTTATTAATACCGTCTGTAGTAAGTGCATAAAGTGC
TGCAAAGTTTTGAGCAAGCCCAAGACATGCTGCAACTTTCATAAGCTCCATCGCATTTTT
AACACCGAGTATTTTATGTGATAACTTAACCTTTGGTAGAATTCCCATAGAACCACCAAC
TGTACCAAGTGCCAAAGGTATTTTTATTTCACCAACTAAAAAATCATCTTTAACATACCA
CTTGGTCAGTGGAATGTATTTACCACTAACTGAAGCATAAGCATGCGCACCAGCCTCAAT
TGAACGGGTGTCATTACCTGTTGCAAGCATTAGAGCACTAATACCATTCATAATTCCTTT
ATTGTGTGTTGCTGCTCTATACGGGTCAATATGTGCATATGTAGAAGCAGCTGCAATATC
TTTATGAATAACATCGGAGTTCTTTAAGTGTTTTGGATCAATTTTTACAGAAGCAGATAC
TAATGCATCCACGGCTAGGTTGGATAGAATACTCATTAAAACTTCAGCCTTATAATCAAT
AGTTACAAAATGACTAATAGCTTCTAAAATGGTATTGATGGTGTTTGCACCCATGGCATC
TAGTGTATTGATACTTGCATAAAAGCATACAAAGCCTTGAGTTTTATCTTCGACTTTAAA
TGACAATAAACCACCACCCAAATTATGAATTTGTGGGTGTGCTTTATAAGCAATATCTTT
AAATGTTTCTTTATGACTATTTAAGTAATCAATTAATGCTTTTGGATCAGATACGTTTTT
AAAAATAATTTGACCAATCATTACACGATTGATTTCATCAATTTTAAAACCACCATTACG
ATAAATTATTTTAGCGGCATGAGCAGCACCAGCAATGACTGAAGGTTCTTCAGTTGCCAT
CGGTATATGGTATAAGACATCGTCAATTAAAAAGTCTGGAGCAACGCCTAAACCCACTTC
ATACGTCGTAATAAAGTTTTCAATCAAGTGGTCAAAAACAATATCACCTGCACTTTTGTT
TAGACTTGCATCGAATCTATCAATAGATTCTAATGCTTCAATACGTTCTTCAATAGATTT
TTTGTAAAAGTTTTTTAGTAATTTATTCAT


>protein sequence
MNKLLKNFYKKSIEERIEALESIDRFDASLNKSAGDIVFDHLIENFITTYEVGLGVAPDF
LIDDVLYHIPMATEEPSVIAGAAHAAKIIYRNGGFKIDEINRVMIGQIIFKNVSDPKALI
DYLNSHKETFKDIAYKAHPQIHNLGGGLLSFKVEDKTQGFVCFYASINTLDAMGANTINT
ILEAISHFVTIDYKAEVLMSILSNLAVDALVSASVKIDPKHLKNSDVIHKDIAAASTYAH
IDPYRAATHNKGIMNGISALMLATGNDTRSIEAGAHAYASVSGKYIPLTKWYVKDDFLVG
EIKIPLALGTVGGSMGILPKVKLSHKILGVKNAMELMKVAACLGLAQNFAALYALTTDGI
NKGHMRLHARNVALEAGAQPSNINEVVNHLVTSKEITVANAKEFIKTLS






















© Fisunov Lab of Proteomics, 2016.