ACL_RS01535


  Uniprot: A9NEZ9
Description: exonuclease
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 33,444
Subunit structure [CC]: 
Gene ontology (GO): exonuclease activity [GO:0004527]; nucleic acid binding [GO:0003676]
Gene ontology IDs: GO:0003676; GO:0004527
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 102 282 Exonuclease. {ECO:0000259|SMART:SM00479}.
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: A9NEZ9
MEROPS: 
EnsemblBacteria KO: ABX80929
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 3.30.420.10
InterPro: 
PANTHER: IPR013520;IPR012337
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: 
ProDom: 
SMART: 
SUPFAM: SM00479
TIGRFAMs: SSF53098
316661-317516(+)

>nucleotide sequence
ATGAGAACTTTTATACACAGTACAGATACAAAACAAAAATTATTTTACGCGGTTGTAAAT
AATAAAAAGGAAACCTTTTATTTACCCAATCGATTAGCTAAAGTATTTTTAACCATTTTA
AAAAAAGGTATATTAGTAGATTTTGAAGTGACTAGTCCCGTCATCAAGTTAGTGGATAAT
CATAAGGTAAGTGTTTATCCAGTATCGCATTTTAACTTGATTATGCAATTAAAACCAAAC
CGTGTATTGTATGATTTAAAACAATTAAGACTAGATATGAAGCGTGTATTAAAAAAATAC
CAATACTTTTTATTTTTAGATCTAGAAATGTCGATGCCAGGATATAAAAAAGGACCACAT
ATCCCTGAAATTATTCAAGTTGGTTATGTATTAGCGGATAAGGCAGGTAACGTTATTAAA
GATAATGGTTATTTTGTAAGAGCTGTCCAAGAAGACGCGATTAATAAAAGAACCATTAAG
TTTCTTGATCTAGATGAAAATAAATATTATGGTAAAGCACTGGATTATGATTTATTCTAT
ATGGATTTAGAAAACTTAATTAAAACATATAAGCCACAAATTGTAACATGGGGTAAAAAT
GATGTGCAAGCCCTAAATATTAGTTATGATCTTCACAAGGTAAAACCACTAACAAGTGAC
AAGCAGTTTATTGACCTTTTAAAACTACATAAAGATTACTTTAACTTACCAAATGATATT
GGACTATTCCAAGCTTATAAAAAATACTATAAGCCAGAAGAAGAACTCGTCCAAGACCAT
GATGCTAGATTAGACGCAATTATTACAAAAGATGTATTTGATGCATTTATGATTCTAATG
CAAACAAGTAATTAA


>protein sequence
MRTFIHSTDTKQKLFYAVVNNKKETFYLPNRLAKVFLTILKKGILVDFEVTSPVIKLVDN
HKVSVYPVSHFNLIMQLKPNRVLYDLKQLRLDMKRVLKKYQYFLFLDLEMSMPGYKKGPH
IPEIIQVGYVLADKAGNVIKDNGYFVRAVQEDAINKRTIKFLDLDENKYYGKALDYDLFY
MDLENLIKTYKPQIVTWGKNDVQALNISYDLHKVKPLTSDKQFIDLLKLHKDYFNLPNDI
GLFQAYKKYYKPEEELVQDHDARLDAIITKDVFDAFMILMQTSN






















© Fisunov Lab of Proteomics, 2016.