ACL_RS01690


  Uniprot: A9NF30
Description: ribonuclease HII
EC number: 3.1.26.4
Annotation score: 2 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: CATALYTIC ACTIVITY: Endonucleolytic cleavage to 5'-phosphomonoester. {ECO:0000255|HAMAP-Rule:MF_00052}.
Cofactor: COFACTOR: Name=Mn(2+); Xref=ChEBI:CHEBI:29035; Evidence={ECO:0000255|HAMAP-Rule:MF_00052}; Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000255|HAMAP-Rule:MF_00052}; ; Note=Manganese or magnesium. Binds 1 divalent metal ion per monomer in the absence of substrate. May bind a second metal ion after substrate binding. {ECO:0000255|HAMAP-Rule:MF_00052}
Enzyme regulation: 
Function [CC]: FUNCTION: Endonuclease that specifically degrades the RNA of RNA-DNA hybrids. {ECO:0000255|HAMAP-Rule:MF_00052}.
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: METAL 24 24 Divalent metal cation. {ECO:0000255|HAMAP-Rule:MF_00052}.; METAL 25 25 Divalent metal cation. {ECO:0000255|HAMAP-Rule:MF_00052}.; METAL 116 116 Divalent metal cation. {ECO:0000255|HAMAP-Rule:MF_00052}.
Nucleotide binding: 
Site: 
Gene names (primary): rnhB
Gene names (synonym): 
Mass: 22,471
Subunit structure [CC]: 
Gene ontology (GO): cytoplasm [GO:0005737]; manganese ion binding [GO:0030145]; RNA binding [GO:0003723]; RNA-DNA hybrid ribonuclease activity [GO:0004523]; RNA catabolic process [GO:0006401]
Gene ontology IDs: GO:0003723; GO:0004523; GO:0005737; GO:0006401; GO:0030145
Chain: CHAIN 1 202 Ribonuclease HII. /FTId=PRO_0000334850.
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the RNase HII family. {ECO:0000255|HAMAP-Rule:MF_00052}.
Protein families: RNase HII family
Coiled coil: 
Domain [FT]: 
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: A9NF30
MEROPS: 
EnsemblBacteria KO: ABX80960
UniPathway: K03470
CDD: 
Gene3D: 
HAMAP: 3.30.420.10
InterPro: MF_00052_B
PANTHER: IPR022898;IPR001352;IPR024567;IPR012337
PIRSF: PTHR10954
PRINTS: 
PROSITE: 
Pfam: 
ProDom: PF01351
SMART: 
SUPFAM: 
TIGRFAMs: SSF53098
350248-350857(+)

>nucleotide sequence
TTGACCATAGACAATCTAGCATTTGAAAAAGCACTTTATGATAAAGGGTATACCTATATT
TGTGGTGTAGATGAAGCTGGACGTGGTCCACTAGCTGGTCCAGTTGTTGCTGCAGCTGTA
ATTTTCGAAAAAGGTTTTTATCATGAAGACATTAATGATTCTAAAACTTTATCAGCTAAA
AAACGTGAAACCTTATTTGAACTCATTAAACAACATGCACTTGCAATTGGTGTAAGTGTT
GTAAATCATGAAGTGATTGATAAAATAAATATATTAGAAGCAGCAAGACATGCAATGGAA
GATGCTATTTCAAAACTAAAGATTAAACCACAATACGCATTAACTGATCATATGGATATA
AAAGGTATACCTTATACCTCCATTAAACATGGCGACCAACTATCTATATCGATTGCTGCA
GCAAGTATAATTGCTAAAGTGACTAGAGATAAATTGATGGTGGATTATGATGAGGTTTAT
CCTCAATACGGATTTAAAGACCATAAAGGTTATGGTACAAGAAAACATTTAGAGGCTCTA
AATTTGTATGGTGTATCACCAATTCACCGTAAAACTTTTGCGCCCGTGGCTAAGTTATTA
AAACAATAA


>protein sequence
LTIDNLAFEKALYDKGYTYICGVDEAGRGPLAGPVVAAAVIFEKGFYHEDINDSKTLSAK
KRETLFELIKQHALAIGVSVVNHEVIDKINILEAARHAMEDAISKLKIKPQYALTDHMDI
KGIPYTSIKHGDQLSISIAAASIIAKVTRDKLMVDYDEVYPQYGFKDHKGYGTRKHLEAL
NLYGVSPIHRKTFAPVAKLLKQ






















© Fisunov Lab of Proteomics, 2016.