ACL_RS01770


  Uniprot: A9NF46
Description: threonine--tRNA ligase
EC number: 6.1.1.3
Annotation score: 3 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: CATALYTIC ACTIVITY: ATP + L-threonine + tRNA(Thr) = AMP + diphosphate + L-threonyl-tRNA(Thr). {ECO:0000255|HAMAP-Rule:MF_00184}.
Cofactor: COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000255|HAMAP-Rule:MF_00184}; ; Note=Binds 1 zinc ion per subunit. {ECO:0000255|HAMAP-Rule:MF_00184}
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: METAL 334 334 Zinc; catalytic. {ECO:0000255|HAMAP-Rule:MF_00184}.; METAL 385 385 Zinc; catalytic. {ECO:0000255|HAMAP-Rule:MF_00184}.; METAL 516 516 Zinc; catalytic. {ECO:0000255|HAMAP-Rule:MF_00184}.
Nucleotide binding: 
Site: 
Gene names (primary): thrS
Gene names (synonym): 
Mass: 75,292
Subunit structure [CC]: SUBUNIT: Homodimer. {ECO:0000255|HAMAP-Rule:MF_00184}.
Gene ontology (GO): cytoplasm [GO:0005737]; ATP binding [GO:0005524]; metal ion binding [GO:0046872]; threonine-tRNA ligase activity [GO:0004829]; threonyl-tRNA aminoacylation [GO:0006435]
Gene ontology IDs: GO:0004829; GO:0005524; GO:0005737; GO:0006435; GO:0046872
Chain: CHAIN 1 642 Threonine--tRNA ligase. /FTId=PRO_1000077346.
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the class-II aminoacyl-tRNA synthetase family. {ECO:0000255|HAMAP-Rule:MF_00184}.
Protein families: Class-II aminoacyl-tRNA synthetase family
Coiled coil: 
Domain [FT]: 
Motif: 
Region: REGION 240 539 Catalytic.
EMBL: CP000896
ProteinModelPortal: A9NF46
MEROPS: 
EnsemblBacteria KO: ABX80976
UniPathway: K01868
CDD: 
Gene3D: cd00771
HAMAP: 3.10.20.30;3.40.50.800
InterPro: MF_00184
PANTHER: IPR002314;IPR006195;IPR004154;IPR012675;IPR004095;IPR012676;IPR002320;IPR018163;IPR033728;IPR012947
PIRSF: 
PRINTS: 
PROSITE: PR01047
Pfam: PS50862
ProDom: PF03129;PF02824;PF00587;PF07973
SMART: 
SUPFAM: SM00863
TIGRFAMs: SSF52954;SSF55186;SSF81271
372063-373992(+)

>nucleotide sequence
ATGATTAAAGTAACATTTCCTGATGGCAACATCAAATCTTACAAAAAAGGTATTACAGTA
TTAGAGGTTGCAGAAGATATTTCGATATCTTTAGCAAAAAAAATAGTTGCAGCTAAATTT
AATGAGGATTTAGTTGAAATATCACGTAAATTAGAACATGATGGTAAATTACAATTACTT
ACTCCAAAAGAGGAACTATCATTTCATGTATTAAATCACTCGGCCGCACACTTAATGGCA
CAAGCTATTCGTAAACTTTATCCAGATGCATTATTTGGGGTAGGGCCAGCAATTGAAGAA
GGCTATTATTATGATGTTGATTTTAAAGACAGTGTCTTTACAGATGCAGATTTAGAAGAG
GTAGAAAAAATGATGAAAAAATTAAGTGAAGAAAATCACTTAATCGAACGTATTGAAGTA
TCCTATGATGAAGCTAGAGACATATTTAAAAATGATCCATATAAATTAGAATTAATTGAA
GTTTATAAAGATGATCAGTTAAGTGTTTATAGACAAGGGGAATTCATCGATTTATGTCGT
GGTGGTCACGTACCTTCCACAAAATACATCAAACACTTTAAACTCTTAAGTATTGCAGGT
GCTTACTGGAGAGGGGATGCTAAAAATAGACAATTAGTACGTGTGTATGGTATTGCTTAT
TTTGAAAAAGCAGAACTTGATAAACATTTAGTGATGCTTGAAGAAAGAAAATTAAGAGAT
CATAGAAAAATCGGTAAAGATTTAGATATCTTTATGACAAGCCAAGAAGTAGGCTCTGGG
TTACCATTTTGGTTACCAAAAGGCGCAACTATTCGCCGCATCATCGAACGTTATATTACT
GATAAAGAGTTAGAATTAGGCTATTTACACGTGTATACACCAATTATGGCTAACGTAGAG
TTTTATAAACAAAGTGGACACTGGGATCACTATCATGAAAACATGTATCCTCCAATGGAT
TTAGGTGATGGAGAAATGTTAGTACTACGTCCAATGAACTGTCCTCACCACATGATGATT
TATAAAAAAGATATTCACTCCTATAGAGAATTGCCAATACGTTTTGCTGAACTAGGTATG
ATGCACCGTTATGAAAAATCAGGCGCGTTAAGTGGTTTACAACGTGTTAGAGAAATGACT
TTAAATGATGCACATATCTTTGTAAGACCTGATCAAATTAAAGAAGAATTTATGCGTGTT
GTGCATTTAATTATTGAAGTATATAAAGACTTTAAGATCACTGATTATAGCTTTAGATTA
AGCTATAGAGATCCAGAAAACAAAGAAAAATACTTTGATGATGATCAAATGTGGCAACGT
GCGGAATCAGAACTTAAAAACGTCATGGATGAAATGAAACTTCCATACAAAGAAGCCATC
GGTGAAGCAGCATTCTATGGACCAAAATTAGATATCCAAGTACGTACTGCAATGGGTATG
GAAGAAACTCTATCCACAGTACAACTAGACTTCTTATTACCGGAACGATTTGACCTAACT
TATGTTGGTGAAGATGGTAAGAATAACCATCGCCCGGTAGTTATTCACCGTGGTGTAGTA
TCTACAATGGAACGTTTTGTAGCATACTTAATTGAAGAATACAAAGGTAGCTTCCCATTA
TGGTTAGCACCAGTTCAATTAAAACTGATTCCTGTAAATTTAGACTTACATAAAGATTAT
GTCATGAATCTACATGAACAATTAAAAAAATTAGGATTTAGAGTAGAATCTGACTTTAGA
AATGAAAAGTTAGGCTATAAGATCCGTGAAGCTCAAACATTAAAAATACCATATCAATTA
GTGGTAGGTGATAATGAGATGAATACACACTCAATTACCTATAGACCATATGGAAGTGAA
AAGCAAATTAATATCTCAATTGATGGCTTCATTAAATTGTTAAATGAACGCATGATCAAT
AAAGACTAA


>protein sequence
MIKVTFPDGNIKSYKKGITVLEVAEDISISLAKKIVAAKFNEDLVEISRKLEHDGKLQLL
TPKEELSFHVLNHSAAHLMAQAIRKLYPDALFGVGPAIEEGYYYDVDFKDSVFTDADLEE
VEKMMKKLSEENHLIERIEVSYDEARDIFKNDPYKLELIEVYKDDQLSVYRQGEFIDLCR
GGHVPSTKYIKHFKLLSIAGAYWRGDAKNRQLVRVYGIAYFEKAELDKHLVMLEERKLRD
HRKIGKDLDIFMTSQEVGSGLPFWLPKGATIRRIIERYITDKELELGYLHVYTPIMANVE
FYKQSGHWDHYHENMYPPMDLGDGEMLVLRPMNCPHHMMIYKKDIHSYRELPIRFAELGM
MHRYEKSGALSGLQRVREMTLNDAHIFVRPDQIKEEFMRVVHLIIEVYKDFKITDYSFRL
SYRDPENKEKYFDDDQMWQRAESELKNVMDEMKLPYKEAIGEAAFYGPKLDIQVRTAMGM
EETLSTVQLDFLLPERFDLTYVGEDGKNNHRPVVIHRGVVSTMERFVAYLIEEYKGSFPL
WLAPVQLKLIPVNLDLHKDYVMNLHEQLKKLGFRVESDFRNEKLGYKIREAQTLKIPYQL
VVGDNEMNTHSITYRPYGSEKQINISIDGFIKLLNERMINKD






















© Fisunov Lab of Proteomics, 2016.