ACL_RS01895


  Uniprot: A9NF71
Description: DNA topoisomerase IV subunit B
EC number: 5.99.1.3
Annotation score: 2 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: CATALYTIC ACTIVITY: ATP-dependent breakage, passage and rejoining of double-stranded DNA. {ECO:0000256|SAAS:SAAS00470725}.
Cofactor: COFACTOR: Name=Mg(2+); Xref=ChEBI:CHEBI:18420; Evidence={ECO:0000256|SAAS:SAAS00609977};
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): parE
Gene names (synonym): 
Mass: 73,014
Subunit structure [CC]: 
Gene ontology (GO): chromosome [GO:0005694]; ATP binding [GO:0005524]; DNA binding [GO:0003677]; DNA topoisomerase type II (ATP-hydrolyzing) activity [GO:0003918]; DNA topological change [GO:0006265]
Gene ontology IDs: GO:0003677; GO:0003918; GO:0005524; GO:0005694; GO:0006265
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Contains Toprim domain. {ECO:0000256|SAAS:SAAS00289629}.
Protein families: 
Coiled coil: COILED 384 408 {ECO:0000256|SAM:Coils}.
Domain [FT]: DOMAIN 426 540 Toprim. {ECO:0000259|PROSITE:PS50880}.
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: A9NF71
MEROPS: 
EnsemblBacteria KO: ABX81001
UniPathway: K02622
CDD: 
Gene3D: 
HAMAP: 3.30.230.10;3.30.565.10;3.40.50.670
InterPro: 
PANTHER: IPR002288;IPR003594;IPR005740;IPR020568;IPR014721;IPR001241;IPR013760;IPR013506;IPR013759;IPR018522;IPR006171
PIRSF: 
PRINTS: 
PROSITE: PR00418
Pfam: PS00177;PS50880
ProDom: PF00204;PF00986;PF02518;PF01751
SMART: 
SUPFAM: SM00387;SM00433
TIGRFAMs: SSF54211;SSF55874;SSF56719
396635-398591(+)

>nucleotide sequence
GTGGCAAAAACAAATTATGACGAGACGAGTATTCAAATATTAGAAGGACTAGAGGCTGTA
CGAAAAAGACCGGGTATGTATATTGGTTCAACTGACCATAGGGGATTACATCATTTGGTT
TGGGAAATCGTAGATAACGCGATGGATGAAGTATTAGCTGGTTTTGGTAGTGAAATTACA
GTAACAATCAAACCTGACAATGCAATCGAAGTACTAGATGATGGACGCGGTATGCCATAT
AAAAAACATACATCTGGGGTTCCAACTACCCAGGTTATTTTTACTGTTTTACATGCAGGA
GGTAAATTTGGTGGCGATGGTGCATATAAAGTAGCTGGTGGTTTACACGGTGTTGGTTCA
TCTGTAGTAAATGCATTATCCTCTGTCTTGGAAGTTACTGTATATAAAGACGGCGGTATT
TTCAGACAACGTTTTGAAAATGGTGGTAAAAAGATATTTAACCAAGAAAAAATAGGAGAT
ACTAAAAAAACTGGTACACAAGTATACTTTAAACCAGATCCGTCTATTTTTTCTACAACG
CTTTATAACTACGATACGATTAAAGAACGATTAAAAGAATCTGCTTACTTAATTAAGGGT
CTAAAAATTAATCTTATTGATGAAAGAAATAATAAAAAAGAAACCTTTAAATTTGATGAA
GGTATTAAAGCCTACGTGGAGTTTATGAACACTGGTAAAAATGCACTACACGATGTAACG
GATGTGGAGGGCACTTTTAATACTGCTAAAGATAGTGCAATTGAAGTCGAAGTTGCCTTA
CAGTATACAGATAGTTATAGTGAAAATATTATTTCGTTTGTAAATAACGTACGTACCAAA
GATGGTGGTACCCATGAAATTGGGTTTAAATCTGCACTTACTAAAGTTATTAATGACTAC
GCTAGAAAATATAATCACATAAAAGAAAAAGATAGTAATATTGATGGCGTAGACATTAGA
GAAGGGCTAACCGCTATTGTATCATTACGTATACCTGAAACAGTCCTAGAGTTTGAAGGG
CAAACTAAAGGTAAGCTAGGAACACCAGAGGCAAGAAATGCACTAGAGACAGTATTTTAT
GAAAAGTTTAACACCTTTTTAGAAGAAAATTCGGATGCTGCTTTATCTATTATTACGAAA
GCTGTTGCTGCAGCTAATGCTAGAGAGGCTGCAAGAAAAGCACGTGAAGAAGCTAGAGCT
GGTAAGAAAAGAAGTAAAAAAGAAGTTATTCTTTCAGGTAAATTAACTCCTGCTCAAGGT
AAAGATAAATCAATTAATGAACTCTTCTTAGTTGAAGGTGATTCTGCTGGTGGTTCTGCT
AAACAAGGTAGAAATAGACGCTTCCAAGCGATTTTACCGCTACGTGGTAAGGTGATTAAC
ACAGAACGCACCAACACAGAAACCATCTTAAAAAACGAAGAAATTTCGACCATGATCTAC
ACCATTGGTGCTGATTTTGGTGAGGATTTTGATATTAAAAAGTGTAACTATAATAAAGTG
ATTATTATGACTGATGCCGATGATGATGGTGCGCATATTCAAACACTTCTTTTAACATTC
TTCTTTAGATACATGAGACCATTAATTGAAGCGGGTAGATTATATATTGCACAGCCTCCA
TTTTATAAAGTAACTTACAAGAAAAACAAAAAAGAAGAAACTGTTTATGCTTGGAGTGAT
GAAGATTTAAAAGAAACACTTGAATCCATTGGACAAAACTACATGATTACACGTTTTAAA
GGGTTAGGCGAAATGAACTTTTATCAGTTATGGGAAACTACAATGAATCCTGAGTCACGT
ACACTGATTCAAGTTACAATCGATGATTTAAACGTTAGTGATAAGCACATTAGTGTATTA
ATGGGTGACCAGGTTGCACCAAGACGTGAATGGATTGAAGCAAACGTTGATTTTGAAGTA
ACTGATGAATTTGACATAGAAGGTAAGGTAAGATGA


>protein sequence
VAKTNYDETSIQILEGLEAVRKRPGMYIGSTDHRGLHHLVWEIVDNAMDEVLAGFGSEIT
VTIKPDNAIEVLDDGRGMPYKKHTSGVPTTQVIFTVLHAGGKFGGDGAYKVAGGLHGVGS
SVVNALSSVLEVTVYKDGGIFRQRFENGGKKIFNQEKIGDTKKTGTQVYFKPDPSIFSTT
LYNYDTIKERLKESAYLIKGLKINLIDERNNKKETFKFDEGIKAYVEFMNTGKNALHDVT
DVEGTFNTAKDSAIEVEVALQYTDSYSENIISFVNNVRTKDGGTHEIGFKSALTKVINDY
ARKYNHIKEKDSNIDGVDIREGLTAIVSLRIPETVLEFEGQTKGKLGTPEARNALETVFY
EKFNTFLEENSDAALSIITKAVAAANAREAARKAREEARAGKKRSKKEVILSGKLTPAQG
KDKSINELFLVEGDSAGGSAKQGRNRRFQAILPLRGKVINTERTNTETILKNEEISTMIY
TIGADFGEDFDIKKCNYNKVIIMTDADDDGAHIQTLLLTFFFRYMRPLIEAGRLYIAQPP
FYKVTYKKNKKEETVYAWSDEDLKETLESIGQNYMITRFKGLGEMNFYQLWETTMNPESR
TLIQVTIDDLNVSDKHISVLMGDQVAPRREWIEANVDFEVTDEFDIEGKVRW






















© Fisunov Lab of Proteomics, 2016.