ACL_RS01910


  Uniprot: A9NF74
Description: hypothetical protein
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 41,760
Subunit structure [CC]: 
Gene ontology (GO): 
Gene ontology IDs: 
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: 
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: ABX81004
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 
InterPro: 
PANTHER: 
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: 
ProDom: 
SMART: 
SUPFAM: 
TIGRFAMs: 
402834-403896(+)

>nucleotide sequence
ATGATTGCATTATCAAACATGAACAGACTTCAAGTATCAACAGACACATTGCTTCTTTTA
CTCAAAGTTTATGAAGCTAAAGGTAAAGAGTTTTATTATGATGAACTCTTTAGTAAAGAT
AAAGATGTGTTTACTAAAAAGGCAATTGAAAAGAATGTTTTTTACTTTGCAAAAATGTTA
GATATGCCACTTACCGATGCAAGACTTAAACTGATGTCTCAAAAGAAGTTAGTCGCAAAA
AATAAGACAGAAAATTTTTTAATTAATATAAAAGATGCGCTTGCATCGATTCAAAAACAC
CCTAAGGAATTTGAACTTTTAACCAATGAGTTTGATAACCTTGCTAGAATGCTATCTAAA
GATTATGAGCCAATTAAGTTCAAGTCCGTGGAAAAGCAAAAGGGTGATACCTTATTTACA
GCAAAAAAAGTAATGGGCAAAAAAGAAGACCTCGATAAAATAATCGAGGTCTACAATGCC
CAAAATAAAACAAAACAATATGAACTAACCCAGTTATTTAGCAATTTTTACATAGATTTT
ATGAATCAAGATCTATTCACACTAGAAAATGAAGTGATTGCCTATATTGGTTTATATGCC
ATGTTACTAAGAGATTTTAGTGTATTTAAATATGTTTCATTCTATGAGTTATTCTTCAAA
CGTTTTGAACAATACAAATTAGCACTCAATCAAGCAAATTACTATTATCAAACAGGGTAT
CCAAATACTGATTTATTATCTAAATTTATATTAGATATCCTAGATGAAGCATATGAATCT
GTTAATAATTATTCTAGAGAATATGCCTTTGAAATCAAGATGAACAAATCAGATAACATT
GAAGCAACCATTAGAACAGGTAAAGAAATATTTTCTAAAGCAGATCTTAGAAGAGAACAC
CCAACTGTTTCTTTAATTACAATCGATAGAACATTAAAGAGATTAAAAGATGAAGGGGTT
ATTCAGTTACTAGGTAAAGGTAGAAGTTCTAAATGGCACCGTATCGATGAAGATAAAAGA
CGTGGTGGTCGTCAATTAGATATCTTTCAATTTACAGATTAA


>protein sequence
MIALSNMNRLQVSTDTLLLLLKVYEAKGKEFYYDELFSKDKDVFTKKAIEKNVFYFAKML
DMPLTDARLKLMSQKKLVAKNKTENFLINIKDALASIQKHPKEFELLTNEFDNLARMLSK
DYEPIKFKSVEKQKGDTLFTAKKVMGKKEDLDKIIEVYNAQNKTKQYELTQLFSNFYIDF
MNQDLFTLENEVIAYIGLYAMLLRDFSVFKYVSFYELFFKRFEQYKLALNQANYYYQTGY
PNTDLLSKFILDILDEAYESVNNYSREYAFEIKMNKSDNIEATIRTGKEIFSKADLRREH
PTVSLITIDRTLKRLKDEGVIQLLGKGRSSKWHRIDEDKRRGGRQLDIFQFTD






















© Fisunov Lab of Proteomics, 2016.