ACL_RS02840


  Uniprot: A9NFQ4
Description: esterase
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 22,168
Subunit structure [CC]: 
Gene ontology (GO): hydrolase activity [GO:0016787]
Gene ontology IDs: GO:0016787
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 9 196 Abhydrolase_2. {ECO:0000259|Pfam:PF02230}.
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: A9NFQ4
MEROPS: 
EnsemblBacteria KO: ABX81184
UniPathway: K06999
CDD: 
Gene3D: 
HAMAP: 3.40.50.1820
InterPro: 
PANTHER: IPR029058;IPR003140
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: 
ProDom: PF02230
SMART: 
SUPFAM: 
TIGRFAMs: SSF53474
602977-603571(+)

>nucleotide sequence
ATGAAACATATCTTTTTAGATAAAAAAAGTGAATATACATTTTTAGCACTACATGGTACA
GGTGGTGATGAAAACGATCTAGTGCCACTAGTAAATTACTTAAACCCTACTTTTAACATA
TTATCACCACGTGGTAATGTGAGTGAACAAGGTATGAACAGATTCTTTAAAAGATATGGT
ATGGGTAACTATGATATCGAAAACTTAGAAGTTGAGACAAATAATCTCAATGAGTTTATT
AGTCTAAGCATAACAAATTATGGACTTGATCAAAGTAAGATGGTAGGTTTAGGATTTTCT
AATGGTGCAAATATTTTAGAATCACTTCTGCAACTTAATGGACCAATTTTAAAGAAAGTT
GTACTACTAAGTCCAGTATTTTTACAACCTGATAAACCGTTTAAAGATTTAACTGGTGTA
GATATCTATATTGCAACATCAGATAATGATCCTTATGTTAAAAATAAGGAAAACGATAAG
CTCGTTGATGCATTAAAAGCTACACATGCAAATGTATATGTAAATAAGCATCACGGTGGT
CACCAAATTAATCAAGCAATTCTAGAAGATTTAAAAAAATGGTTGACGAAATAA


>protein sequence
MKHIFLDKKSEYTFLALHGTGGDENDLVPLVNYLNPTFNILSPRGNVSEQGMNRFFKRYG
MGNYDIENLEVETNNLNEFISLSITNYGLDQSKMVGLGFSNGANILESLLQLNGPILKKV
VLLSPVFLQPDKPFKDLTGVDIYIATSDNDPYVKNKENDKLVDALKATHANVYVNKHHGG
HQINQAILEDLKKWLTK






















© Fisunov Lab of Proteomics, 2016.