ACL_RS02945


  Uniprot: A9NFS7
Description: type I site-specific restriction-modification system, S (specificity) subunit
EC number: 3.1.21.3
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): hsdS1
Gene names (synonym): 
Mass: 47,383
Subunit structure [CC]: 
Gene ontology (GO): DNA binding [GO:0003677]; Type I site-specific deoxyribonuclease activity [GO:0009035]; DNA modification [GO:0006304]
Gene ontology IDs: GO:0003677; GO:0006304; GO:0009035
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 44 182 Methylase_S. {ECO:0000259|Pfam:PF01420}.
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: A9NFS7
MEROPS: 
EnsemblBacteria KO: ABX81207
UniPathway: K01154
CDD: 
Gene3D: 
HAMAP: 
InterPro: 
PANTHER: IPR000055
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: 
ProDom: PF01420
SMART: 
SUPFAM: 
TIGRFAMs: 
622899-624159(+)

>nucleotide sequence
ATGAGCTTTGATCAATGGAGTAAAGTCAATTTGGTGGATTGTCTCGACAAATTGATTGAT
TATAGAGGTAAAACACCAGCAAAATCAGAAAAAGGGATATTAACGTTAAGTGCAAAATCA
GTTAAAAACAGTAACATAGATTACAGTGAGGCATACACTATTTCAGAAGATGAATATAAA
AAGTTTATGGTTAGAGGAATTCCCGTCAAAGGGGATATTCTAATAACAACTGAAGCACCA
ATGGGACAGGTTGCAAAACTAGATAGAGATGGAGTAGCAGTTGCACAAAGATTGTTGACA
TTAAGACCAAATCCCAAGATTCTAGACAATGATTATTTGTTATATTATTTGCAATCACCT
ATAGGACAAGCAGAACTTAAGGCTAGAGAAAGTGGGTCAACAGTAACTGGTATTAAGCAG
GCAGAGTTTAGAAAGATTAACATTATTCTTCCTCCACTTAGTGAACAAAAAGTAATAGCA
AACATCCTCTCATCTCTTGATGACAAAATAGAACTCAACAACAAAATCAATAAAAACCTT
GAAGAATTAGCACAAACACTCTACAAGAGATGGTTTGTGGATTTTGATTTTCCTAATGAA
GAGGGAGAATCCTACAAATCCAGCGGTGGGGAAATGGTTGAAAGTGAATTAGGATTGATT
CCTAAAGGATGGAAAGTGGAATCAATTGGACGAAGCTCAATCTCAAAACTTATTAGTTCA
GGTATTAATGAATTTAATGGGACAAAAAAATATATTGCAACAGCGGATGTTACAAACCTT
TCAATAAGATCATTCGTTACTGAGATAGATTTCAAGAAGCGACCATCTAGAGCTAACATG
CAGCCCATAGCTGGGAGTCTATGGTTTGCAAAAATGAAGGATTCAAGAAAAATGATTAGA
GTATCTAAGAGTAGTAGTTATCTAATCGATAAGTGTATTTTCTCAACGGGTTTCGCAGGA
TTATTCGCTCCGAAATATTCAAATTACATTTGGACAATTTTAACTACTAAAGATTTTGAT
GATACAAAAAATAATCTATGCAATGGAACAACAATGCAAGCAATAAATAATGAGAATATT
AATAGGATCAGAATTCTAATTCCTGATAACAAAACACTTGACTTATTTGAAAGTGTATCA
GAACCTATTTTTGAGAAAATACAGTTTAATGAAATCGAAAGTAATAAATTGTCAAAGATT
CGTGATGAATTACTACCCAAACTAATGAATGGTGAAATCGAAGTACCAATTGAGGAGTGA


>protein sequence
MSFDQWSKVNLVDCLDKLIDYRGKTPAKSEKGILTLSAKSVKNSNIDYSEAYTISEDEYK
KFMVRGIPVKGDILITTEAPMGQVAKLDRDGVAVAQRLLTLRPNPKILDNDYLLYYLQSP
IGQAELKARESGSTVTGIKQAEFRKINIILPPLSEQKVIANILSSLDDKIELNNKINKNL
EELAQTLYKRWFVDFDFPNEEGESYKSSGGEMVESELGLIPKGWKVESIGRSSISKLISS
GINEFNGTKKYIATADVTNLSIRSFVTEIDFKKRPSRANMQPIAGSLWFAKMKDSRKMIR
VSKSSSYLIDKCIFSTGFAGLFAPKYSNYIWTILTTKDFDDTKNNLCNGTTMQAINNENI
NRIRILIPDNKTLDLFESVSEPIFEKIQFNEIESNKLSKIRDELLPKLMNGEIEVPIEEW






















© Fisunov Lab of Proteomics, 2016.