ACL_RS04770


  Uniprot: A9NGU4
Description: divalent cation transporter
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 49,572
Subunit structure [CC]: 
Gene ontology (GO): integral component of membrane [GO:0016021]; cation transmembrane transporter activity [GO:0008324]
Gene ontology IDs: GO:0008324; GO:0016021
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 190 246 CBS. {ECO:0000259|PROSITE:PS51371}.
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: A9NGU4
MEROPS: 
EnsemblBacteria KO: ABX81574
UniPathway: K06213
CDD: 
Gene3D: 
HAMAP: 1.10.357.20
InterPro: 
PANTHER: IPR000644;IPR006668;IPR006667
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: PS51371
ProDom: PF01769;PF03448
SMART: 
SUPFAM: 
TIGRFAMs: 
987654-988977(-)

>nucleotide sequence
TTATGCCAGTAAAATGATTGCTGCAATGATAAAGTAACTTCCTAGTGCAAAAAAGTCATT
GATTGTGGTAATTAGTGGACCGCTTGCCGCTTTTTCATCTAGATTAAACTTGCGCAGTAT
CATCGGTGTTAGGACACCAAATAGTGCAGATAAAACCATAGATATAAATATAGATAATGA
TACAACCAGTGCAACCAAGTTCATATCTGTATAGGTATTAGGTAGGATGTTTAAAAACGC
ATAGACAAATCCACCACCTATAACACCTGAAATCAAACCATTTAAGAAGCCAATCCCAAG
TTCAAAAAAGACATCTTTTTTGAATAATTGGGGTTGATTCTGTAGTTTTAAAATGGATAC
AGCAATACTTTGAGTACCAATGTTACCTGCCATACCAAGTATAAGTGGTTGAAATAAAAT
AAGCGCAACATTCGTTTCTAGAACATTACTAAATCCAGAAAGAGCACTTACTATCATAAT
ATTTAATAAAGCACATATCACTAGCCAAGGTAAACGGTTCATAGAGCGCTTTAAAGCGGA
ATCAGTATCACTTATTGTATGAGCTTTAACTAAACTCGTAATGGTTTCTGTATGTAATTC
ATCCATAATCGTTAAGGCATCATCTAATAAGATAATACCAATTTGTTTATGGTCATGATC
AAGTACTGGAATGATTTCTATATCATAGTCTCTAATCTTTTTAATAGCAAGTTCAATTGG
GTCATCTGAATATACAAAAGGATATTGATCATTGATGAGTTTTTCTAGACTTTGATTTGC
TCTTGCAATTATCAGTTCTTGAAGTGGAATAGCACCTTTATATAAATCATCTTGGTCATG
GAAAAAGATAACATCAAGTTCATCTTTTTCAGTGACTTCTGTTGTCACATAATGTGTTGC
TTCTTTTACAGTTAATGTATTGGATAGATTGACAAAGTGTGGAGATGATAAGGCACCTGA
TGAGTCTACTTCATAGGTAAATAACTGCATAATTTCATTCTTAGTTTTTTCTTGCAATAA
AGAGATGATAAATATTTGTTTTTGAACCTCATGTAAATCAATAAATGCTTTAATATCTTC
AGTATCTAAAAACTTTAACATGGATTGTTTTTGCTCTTTTGTAAGTTCATCAAAAAACTC
TATTTGAATGTCTTCGTCCAGTAATACAAATACATGTTTAAACATTTTAACACCGAGTGC
TTGAAAGATTTTCATACGGTAGTCTTCATGGTCTTTAAATACTGTAGCAATATCAGAAGC
ATGATACTTTTGAAGCTGTACTTTTAACTTTTGTACAGATGCATTTAAGTCAATATTACG
CAT


>protein sequence
MRNIDLNASVQKLKVQLQKYHASDIATVFKDHEDYRMKIFQALGVKMFKHVFVLLDEDIQ
IEFFDELTKEQKQSMLKFLDTEDIKAFIDLHEVQKQIFIISLLQEKTKNEIMQLFTYEVD
SSGALSSPHFVNLSNTLTVKEATHYVTTEVTEKDELDVIFFHDQDDLYKGAIPLQELIIA
RANQSLEKLINDQYPFVYSDDPIELAIKKIRDYDIEIIPVLDHDHKQIGIILLDDALTIM
DELHTETITSLVKAHTISDTDSALKRSMNRLPWLVICALLNIMIVSALSGFSNVLETNVA
LILFQPLILGMAGNIGTQSIAVSILKLQNQPQLFKKDVFFELGIGFLNGLISGVIGGGFV
YAFLNILPNTYTDMNLVALVVSLSIFISMVLSALFGVLTPMILRKFNLDEKAASGPLITT
INDFFALGSYFIIAAIILLA






















© Fisunov Lab of Proteomics, 2016.