ACL_RS04870
  | Uniprot: A9NGW5
Description: ATP synthase subunit delta EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01416}.; FUNCTION: This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. {ECO:0000255|HAMAP-Rule:MF_01416}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): atpH Gene names (synonym): Mass: 20,220 Subunit structure [CC]: SUBUNIT: F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. {ECO:0000255|HAMAP-Rule:MF_01416}. Gene ontology (GO): plasma membrane [GO:0005886]; proton-transporting ATP synthase complex, catalytic core F(1) [GO:0045261]; proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]; plasma membrane ATP synthesis coupled proton transport [GO:0042777] Gene ontology IDs: GO:0005886; GO:0042777; GO:0045261; GO:0046933 Chain: CHAIN 1 171 ATP synthase subunit delta. /FTId=PRO_0000382047. Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ATPase delta chain family. {ECO:0000255|HAMAP-Rule:MF_01416}. Protein families: ATPase delta chain family Coiled coil: Domain [FT]: Motif: Region: EMBL: CP000896 ProteinModelPortal: A9NGW5 MEROPS: EnsemblBacteria KO: ABX81595 UniPathway: K02113 CDD: Gene3D: HAMAP: 1.10.520.20 InterPro: MF_01416 PANTHER: IPR026015;IPR000711 PIRSF: PRINTS: PROSITE: PR00125 Pfam: ProDom: PF00213 SMART: SUPFAM: TIGRFAMs: SSF47928 |
1009089-1009605(-) >nucleotide sequence TTGATATGTCATCTTTACACCTTCTATTAATGTTGGATCAATATGTTGGTTGAATTCGAT TTCTAGACCAGGTAGGTAGTCTTGAATTTCTTCTTTTAATTGATTTAATCTTTTTTTGCT AAGTGGCTTAGCTGAATATAATTGTACATAAGCGATTTTTTGGTTTAGTCTAGATTTAGC AATCCATTGTTCGTATATATCTTCGTATAGTCTCACTTGATGATGACGAACAAGCAGCAT TAAAAAATTCATGAATAAAGCATCAAATATGCCAAGTTCTGTTAACATTTTATTTTTGAC TCTATTTCTAATCATTGGAGAGTCTAATAAAACGATCCAGTCCGGGTAATCTCTTGCGAG TGATACAAACGTCTCAAACTGTTCAATGATAGATTCGATAGCGTCTTCTTTAAGTGCAAG CTTAAAGAGTGCATCAGAATAAATAGTTGATGTCAT >protein sequence LGIFDALFMNFLMLLVRHHQVRLYEDIYEQWIAKSRLNQKIAYVQLYSAKPLSKKRLNQL KEEIQDYLPGLEIEFNQHIDPTLIEGVKMTYQGRSIERSLKKALDDMRTNI |
© Fisunov Lab of Proteomics, 2016.