ACL_RS04880


  Uniprot: A9NGW7
Description: ATP F0F1 synthase subunit C
EC number: 
Annotation score: 3 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: FUNCTION: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000255|HAMAP-Rule:MF_01396}.; FUNCTION: Key component of the F(0) channel; it plays a direct role in translocation across the membrane. A homomeric c-ring of between 10-14 subunits forms the central stalk rotor element with the F(1) delta and epsilon subunits. {ECO:0000255|HAMAP-Rule:MF_01396}.
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: SITE 70 70 Reversibly protonated during proton transport. {ECO:0000255|HAMAP-Rule:MF_01396}.
Gene names (primary): atpE
Gene names (synonym): 
Mass: 8,812
Subunit structure [CC]: SUBUNIT: F-type ATPases have 2 components, F(1) - the catalytic core - and F(0) - the membrane proton channel. F(1) has five subunits: alpha(3), beta(3), gamma(1), delta(1), epsilon(1). F(0) has three main subunits: a(1), b(2) and c(10-14). The alpha and beta chains form an alternating ring which encloses part of the gamma chain. F(1) is attached to F(0) by a central stalk formed by the gamma and epsilon chains, while a peripheral stalk is formed by the delta and b chains. {ECO:0000255|HAMAP-Rule:MF_01396}.
Gene ontology (GO): integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; proton-transporting ATP synthase complex, coupling factor F(o) [GO:0045263]; hydrogen ion transmembrane transporter activity [GO:0015078]; lipid binding [GO:0008289]; ATP hydrolysis coupled proton transport [GO:0015991]; ATP synthesis coupled proton transport [GO:0015986]
Gene ontology IDs: GO:0005886; GO:0008289; GO:0015078; GO:0015986; GO:0015991; GO:0016021; GO:0045263
Chain: CHAIN 1 86 ATP synthase subunit c. /FTId=PRO_0000365840.
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the ATPase C chain family. {ECO:0000255|HAMAP-Rule:MF_01396}.
Protein families: ATPase C chain family
Coiled coil: 
Domain [FT]: 
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: A9NGW7
MEROPS: 
EnsemblBacteria KO: ABX81597
UniPathway: K02110
CDD: 
Gene3D: 
HAMAP: 1.20.20.10
InterPro: MF_01396
PANTHER: IPR000454;IPR005953;IPR020537;IPR002379
PIRSF: 
PRINTS: 
PROSITE: PR00124
Pfam: PS00605
ProDom: PF00137
SMART: 
SUPFAM: 
TIGRFAMs: SSF81333
1010140-1010380(-)

>nucleotide sequence
TTACTTACTTGATAATATAAATGCAATAATTAATGCATAAATACCAGAAGTTTCTACCAT
CGCTTGACCTAAAATCATGGTCACTGTAATTTTACCACTTGCCTCTGGTTGGCGGCCTAC
AGCCTCAACCGCACGTGCAGCAGCCAGCCCTTGTCCAATACCTGCTAAACCAGCAGCCAA
AATGGAAATACCAGCGCCTAAGTATGCTAAACCTGTAGCAAAAAATTCAGTTTGTGTCAT


>protein sequence
MTQTEFFATGLAYLGAGISILAAGLAGIGQGLAAARAVEAVGRQPEASGKITVTMILGQA
MVETSGIYALIIAFILSSK






















© Fisunov Lab of Proteomics, 2016.