ACL_RS04955


  Uniprot: A9NGY2
Description: hypothetical protein
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 19,753
Subunit structure [CC]: 
Gene ontology (GO): integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; transport [GO:0006810]
Gene ontology IDs: GO:0005886; GO:0006810; GO:0016021
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the binding-protein-dependent transport system permease family. {ECO:0000256|RuleBase:RU363032}.; SIMILARITY: Contains 1 ABC transmembrane type-1 domain. {ECO:0000256|RuleBase:RU363032}.
Protein families: Binding-protein-dependent transport system permease family
Coiled coil: 
Domain [FT]: DOMAIN 15 180 ABC transmembrane type-1. {ECO:0000259|PROSITE:PS50928}.
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: A9NGY2
MEROPS: 
EnsemblBacteria KO: ABX81612
UniPathway: K02072
CDD: 
Gene3D: cd06261
HAMAP: 1.10.3720.10
InterPro: 
PANTHER: IPR000515
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: PS50928
ProDom: PF00528
SMART: 
SUPFAM: 
TIGRFAMs: SSF161098
1024017-1024566(+)

>nucleotide sequence
ATGATCATGTTTATCAGTCAAATAGATCAATTAAAACTCATAGATGCTGCACTTGAAACA
TTCAATCTATTATTGGTAAGTACATTAATATCCTTACCAATTGGTACATTACTTGGTATG
ATGTTTGCACTTTATGAAAAGAAAGTATTTCATCAGTTTAAATCTCTTGTACATATACTT
TCTATTTTAGTAAGTATCATACGTTCCATTCCATTTGTTTTATTGATGGTTATCATCATA
CCAACATCATTTGATCTATTTGGTACAAGTATTGGTTTCATACCTTCTATTATGGCATTA
AGCCTGATTGGAATAGCTACATTAGCTAGACTCGTGGAACAAGCTATCATAGATATGAAT
CCAATGATAATTGATATTGCACACACAATGGGTGCATCTAAATATCAATTATTTAAAGAG
TTTATCTTTGTAGAAGCAAGATCATCCATAATCTTAGCGTTTACTTCGTTTTTGGTAAGT
CTACTTGCTTATTCTTCTGTGGTTTATATTATCGGTGGTGGAGGATTAGGCTATACTGCG
ATTCAATAG


>protein sequence
MIMFISQIDQLKLIDAALETFNLLLVSTLISLPIGTLLGMMFALYEKKVFHQFKSLVHIL
SILVSIIRSIPFVLLMVIIIPTSFDLFGTSIGFIPSIMALSLIGIATLARLVEQAIIDMN
PMIIDIAHTMGASKYQLFKEFIFVEARSSIILAFTSFLVSLLAYSSVVYIIGGGGLGYTA
IQ






















© Fisunov Lab of Proteomics, 2016.