ACL_RS05085


  Uniprot: A9NH08
Description: L-lactate dehydrogenase
EC number: 1.1.1.27
Annotation score: 3 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: CATALYTIC ACTIVITY: (S)-lactate + NAD(+) = pyruvate + NADH. {ECO:0000256|HAMAP-Rule:MF_00488}.
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: PATHWAY: Fermentation; pyruvate fermentation to lactate; (S)-lactate from pyruvate: step 1/1. {ECO:0000256|HAMAP-Rule:MF_00488}.
Active site: ACT_SITE 175 175 Proton acceptor. {ECO:0000256|HAMAP-Rule:MF_00488, ECO:0000256|PIRSR:PIRSR000102-1}.
Binding site: BINDING 88 88 Substrate. {ECO:0000256|HAMAP-Rule:MF_00488}.; BINDING 120 120 NAD or substrate. {ECO:0000256|HAMAP-Rule:MF_00488}.; BINDING 151 151 Substrate. {ECO:0000256|HAMAP-Rule:MF_00488}.; BINDING 230 230 Substrate. {ECO:0000256|HAMAP-Rule:MF_00488}.
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: NP_BIND 11 39 NAD. {ECO:0000256|HAMAP-Rule:MF_00488}.
Site: 
Gene names (primary): ldh
Gene names (synonym): 
Mass: 35,092
Subunit structure [CC]: SUBUNIT: Homotetramer. {ECO:0000256|HAMAP-Rule:MF_00488}.
Gene ontology (GO): cytoplasm [GO:0005737]; L-lactate dehydrogenase activity [GO:0004459]; glycolytic process [GO:0006096]
Gene ontology IDs: GO:0004459; GO:0005737; GO:0006096
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the LDH/MDH superfamily. LDH family. {ECO:0000256|HAMAP-Rule:MF_00488}.
Protein families: LDH/MDH superfamily, LDH family
Coiled coil: 
Domain [FT]: DOMAIN 4 142 Ldh_1_N. {ECO:0000259|Pfam:PF00056}.; DOMAIN 145 311 Ldh_1_C. {ECO:0000259|Pfam:PF02866}.
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: A9NH08
MEROPS: 
EnsemblBacteria KO: ABX81638
UniPathway: K00016
CDD: 
Gene3D: 
HAMAP: 3.40.50.720;3.90.110.10
InterPro: MF_00488
PANTHER: IPR001557;IPR011304;IPR018177;IPR022383;IPR001236;IPR015955;IPR016040
PIRSF: PTHR11540
PRINTS: PIRSF000102
PROSITE: PR00086
Pfam: PS00064
ProDom: PF02866;PF00056
SMART: 
SUPFAM: 
TIGRFAMs: SSF51735;SSF56327
1053557-1054502(+)

>nucleotide sequence
ATGAAAAATAGAGTTGTTATTGTAGGTACTGGTTTTGTAGGCATGAGCTATGCTTATGCA
CTTTTAAACCAAGGAACTTTAGAAGAAATTATATTAGTAGATATTGATTCAAGAAAAGCC
GAAGGTGAGGCAATGGATTTAAACCATGGGCTAGCGTTTGCACCAAGAAAGATGCTCATT
CGTTCTGGTACATATGAAGATTGTAAGGATGCTAAACTAGTTGTTATTACAGCAGGCGTT
AATCAAAAAGATGGAGAAACAAGAATTGATCTTTTAAACAGAAATGCTAAGATTATGCAG
TCTGTTGTAAAAGAGATTATGAAACATGGTTTTAACGGCATCTTTTTAGTTGCAACAAAC
CCGGTGGATATCTTAACCTATATTGTATGGAAATCCTCTGGATTACCATCAAATAGAGTC
ATTGGTAGTGGTACTTCTCTTGATACTGCAAGACTTCGTTATGAGATATCTCAATACATC
AACATTGATGTTCGAAACATCCATGCATATATCTTAGGTGAACATGGAGATTCTGAGTTT
GTTTGTTGGTCAAATGCCTTTGTTGGCGTTAAACCTTTAAAAGATGTTATAGACTCCATG
CCTGCACAAATAAAGTTTTCTGATTTAGATAAGATTTACCTTGACGTAAAAAATTCAGCC
TATGAAATTATCCAAAGAAAAAGAGCCACTTATTATGGTATTGGTATGGCCTTAGTACGT
ATAACAAAGGCTATTTTCAATAATGAAAACAGAATTCTACCCATATCAGTATTTAACGAT
GATGACTATGATATTGATAATCTCTATATTGGCTTACCAGCTGTATTAAATGAAAATGGG
GTAGACCATGTAGTAAAACTTAATTTAAATGATGAAGAGTTAAAATCACTTAAAAAATCT
TCAAGTATATTAAAACATAGTATAGATTCCATCACTTTAGAATAG


>protein sequence
MKNRVVIVGTGFVGMSYAYALLNQGTLEEIILVDIDSRKAEGEAMDLNHGLAFAPRKMLI
RSGTYEDCKDAKLVVITAGVNQKDGETRIDLLNRNAKIMQSVVKEIMKHGFNGIFLVATN
PVDILTYIVWKSSGLPSNRVIGSGTSLDTARLRYEISQYINIDVRNIHAYILGEHGDSEF
VCWSNAFVGVKPLKDVIDSMPAQIKFSDLDKIYLDVKNSAYEIIQRKRATYYGIGMALVR
ITKAIFNNENRILPISVFNDDDYDIDNLYIGLPAVLNENGVDHVVKLNLNDEELKSLKKS
SSILKHSIDSITLE






















© Fisunov Lab of Proteomics, 2016.