ACL_RS06340


  Uniprot: A9NHP6
Description: magnesium-translocating P-type ATPase
EC number: 3.6.3.2
Annotation score: 2 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): mgtA2
Gene names (synonym): 
Mass: 97,843
Subunit structure [CC]: 
Gene ontology (GO): integral component of membrane [GO:0016021]; ATP binding [GO:0005524]; magnesium-importing ATPase activity [GO:0015444]; metal ion binding [GO:0046872]; magnesium ion transport [GO:0015693]
Gene ontology IDs: GO:0005524; GO:0015444; GO:0015693; GO:0016021; GO:0046872
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 22 95 Cation_ATPase_N. {ECO:0000259|SMART:SM00831}.
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: A9NHP6
MEROPS: 
EnsemblBacteria KO: ABX81876
UniPathway: K01531
CDD: 
Gene3D: 
HAMAP: 1.20.1110.10;2.70.150.10;3.40.1110.10
InterPro: 
PANTHER: IPR006068;IPR004014;IPR023299;IPR018303;IPR023298;IPR008250;IPR023214;IPR006415;IPR001757
PIRSF: PTHR24093:SF128
PRINTS: 
PROSITE: PR01836
Pfam: PS00154
ProDom: PF00689;PF00690;PF00122
SMART: 
SUPFAM: SM00831
TIGRFAMs: SSF56784;SSF81660
1336250-1338887(+)

>nucleotide sequence
ATGAAAAAAGAAAAAACATTTAACACAGTAAACACGACTTCTAGTTTAGAAGATAAGTTA
ATACAAAACGCACACATAGATAAACAATCTCTATTTAACAAATACAACACAAGTCAAAAC
GGGCTTTCAACTGATGAAAGTATATTAAGATTTGAAACATACGGGAAAAATGTTATCACA
TCTAAACAAAAGGATTCTAAATTTAGAAGACTACTCTCATCTATTGTAAATCCATTTAAC
TTGATATTGATTGCTATTGCAATTATTACTTTCTTAACAGATGTTATTTTTGTAAAGGGT
AACCCTGATTTTTTAACTGTTATTATTATCTTTATACTCGTAACAGTATCTAGTTCTATT
TCATTTATGCAAAGCGAGAAATCCCGTAATGCAGTTGAAGAACTCACAAATCTTGTAACA
AACAATTCAAATATACTGCGAGATGGAAAATGGATAGAAATACCTATTGAAAATATAGTA
CCTGGAGATATCATAAAACTAGCTGCAGGTGATATGATACCTGCAGATATTAGATTTCTA
ACTACAAAGGATACCTTTGTTGCACAATCTGCACTAACAGGGGAATCACACCCTGTTGAA
AAATTTAGTAACATAAGTTCAAAAGATATAGACATTATCACCGATTTAGATAACATTGGC
TTTATGGGATCTAATATATTAAGTGGCAGTGCAACTGCACTTGTCATCTCAACAGGTAAT
CACACCTACTTTGGATCTATGGCAAAAACATTATCTGGTGATAATGCCACAAAGAGTTTT
GAACGAGGCGTTTCTTCAATTAGTAGACTTTTAATAAGCTTAACTCTTATAATGGTACCC
ATGGTGTTTTTAATTAACGGAATTATTAAACAAGACTGGCTTCAATCATTAATGTTTGCT
ATTAGTATAGCAGTTGGATTAACACCTGAAATGTTGCCTGTTATCATGACAACAACACTT
GCTAAGGGTGCTGTTAGCATGTCAAAACATAAAGTCGTTGTGAAAAATCTTGGGACTATC
CAAACATTTGGTGAAATGGACATCTTATGTACAGACAAGACAGGAACATTAACAGAAGAT
AAAATCGTATTAGAAAAATATATGAATCTTCACGGTGAAGATGATGATAGAGTGCTTCGT
CATGCTTTCTTAAACAGTTATTTTCAAACTGGACTTAAAAATCTAATTGACCTTGCGATT
ATAAACCGTGCTACAAAAAAAGATCTAAAACCATTGACTACACGCTATGAAAAAATAGAT
GAAATTCCATTTGATTTTTCACGAAGAAGAATGAGTGTAGTATTAATTGATAAAGATAAT
AAACGTCAACTTATCACCAAAGGTGCAGTTGAAGAGATGCTTGAAATTTCTAAATTTGTT
GAAATCAATGGCCAAGTATTAGAATTAACTGATGCATATAAGAAATTTGCAATGGCTACA
TATGAAAAATACAACAAAGAAGGCTTAAGAATTATTGCAGTTGCACAAAAAAATGAAGTT
CCAAAAGAACATATCTTTAGTGTAAAAGATGAATCTAATATGGTACTAATTGGTTTTGTA
GGGTTTTTAGATCCACCTAAAAAAAGTGCTTCTATTGCGATTAACAAACTTAGAGATCAC
GGAGTTAGAACAATCGTTCTAACTGGTGATAGCGAAGGTGTTACAGCAAAAGTTTGTAAA
GAAATCGGAATTAGCATTGATCATATAATTTCAGGTAATGAAGTTGATTCACTAAGTGAT
CAAGATTTAAAAGAAAAACTTAAAATATGTAACATATTTGCAAAATTATCACCTAATCAA
AAACAAAGAATTGTGAAGTTATTACAAGAAGAGGGACATACAGTCGGATTTTTAGGTGAT
GGTATTAATGATGCTCCAGCACTTCACCAAGCTGATGTTGGTATTTCAGTAGATTCTGCT
GTTGATATTGCAAAAGAAACTGCAGATATCGTACTACTAGAAAAAGATTTAGTAGTACTA
GAAGAAGGCGTTCTTGAAGGTAGAAAAACTTTTGGTAATATTATGAAATATATCAAAATG
GCTACCAGTGGAAATTTCGGTAACATGATATCTGTAATTGTTGCAAGTATATTTCTTCCA
TTCTTACCTATGCTACCAGTCCAACTCTTGGCACAAAACTTACTCAATGATTTTTCACAA
GTAGGTATGGCTTTTGACAACGTTGATAAGGAATATATCTATAAACCCCATAAATGGAAT
TCAAAAAGTGTATTAAGATTTACTTTAGTTATGGGACCACTAAGTTCTATTTTCGATATC
TTATGCTTTTCTATCCTATGGTGGGTAATCGGAACCAACACTGTACAAATGGCACCATTA
TTCCAAGCTGGATGGTTTGTATTTGGGACAGTCTCACAAATCTTAGTTATTTATGTAATT
AGAACTCAAAAGTTATCCATTATTGAAAGTAGACCATCTAAAATATTATTTATCTCAACT
TTATTTGTGGCATTAATTGCTATAGTTATAGGATTTACTGACATTGGTGTAGCAATTGAT
ATTGACAGACTTCCTATAAGTTTTATATTATGGTTATCTATATTATCATTAGCATATATG
ATAAGTGCTGAACTTGTCAAAAAGATATATCTAAGAAGGTATAACGAATGGATCTAA


>protein sequence
MKKEKTFNTVNTTSSLEDKLIQNAHIDKQSLFNKYNTSQNGLSTDESILRFETYGKNVIT
SKQKDSKFRRLLSSIVNPFNLILIAIAIITFLTDVIFVKGNPDFLTVIIIFILVTVSSSI
SFMQSEKSRNAVEELTNLVTNNSNILRDGKWIEIPIENIVPGDIIKLAAGDMIPADIRFL
TTKDTFVAQSALTGESHPVEKFSNISSKDIDIITDLDNIGFMGSNILSGSATALVISTGN
HTYFGSMAKTLSGDNATKSFERGVSSISRLLISLTLIMVPMVFLINGIIKQDWLQSLMFA
ISIAVGLTPEMLPVIMTTTLAKGAVSMSKHKVVVKNLGTIQTFGEMDILCTDKTGTLTED
KIVLEKYMNLHGEDDDRVLRHAFLNSYFQTGLKNLIDLAIINRATKKDLKPLTTRYEKID
EIPFDFSRRRMSVVLIDKDNKRQLITKGAVEEMLEISKFVEINGQVLELTDAYKKFAMAT
YEKYNKEGLRIIAVAQKNEVPKEHIFSVKDESNMVLIGFVGFLDPPKKSASIAINKLRDH
GVRTIVLTGDSEGVTAKVCKEIGISIDHIISGNEVDSLSDQDLKEKLKICNIFAKLSPNQ
KQRIVKLLQEEGHTVGFLGDGINDAPALHQADVGISVDSAVDIAKETADIVLLEKDLVVL
EEGVLEGRKTFGNIMKYIKMATSGNFGNMISVIVASIFLPFLPMLPVQLLAQNLLNDFSQ
VGMAFDNVDKEYIYKPHKWNSKSVLRFTLVMGPLSSIFDILCFSILWWVIGTNTVQMAPL
FQAGWFVFGTVSQILVIYVIRTQKLSIIESRPSKILFISTLFVALIAIVIGFTDIGVAID
IDRLPISFILWLSILSLAYMISAELVKKIYLRRYNEWI






















© Fisunov Lab of Proteomics, 2016.