ACL_RS07055


  Uniprot: A9NE57
Description: deoxyribodipyrimidine photo-lyase
EC number: 4.1.99.3
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): phrB
Gene names (synonym): 
Mass: 55,259
Subunit structure [CC]: 
Gene ontology (GO): deoxyribodipyrimidine photo-lyase activity [GO:0003904]; DNA repair [GO:0006281]
Gene ontology IDs: GO:0003904; GO:0006281
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 20 149 Photolyase/cryptochrome alpha/beta. {ECO:0000259|PROSITE:PS51645}.
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: A9NE57
MEROPS: 
EnsemblBacteria KO: ABX82017
UniPathway: K01669
CDD: 
Gene3D: 
HAMAP: 3.40.50.620
InterPro: 
PANTHER: IPR005101;IPR008148;IPR032673;IPR006050;IPR014729
PIRSF: PTHR10211:SF0
PRINTS: 
PROSITE: 
Pfam: PS01084;PS51645
ProDom: PF00875
SMART: 
SUPFAM: 
TIGRFAMs: SSF48173;SSF52425
1488953-1490330(-)

>nucleotide sequence
TTATAGTGTATTGACGTAATCTAGGTAAGTTTTCATATCAAATTTTCGAATCAGACCTTG
TTCGTTCATATATCTTAATTTACCAAATATAGCTCGCTCTTGCCAAGCTCTATCATGTTT
ACCAAAGTTCCATGCGATATTACCATAAGAGTTTGGATTTCTGCCATCGATAAAGTATTT
ATTATTTAAGTAGACTATGATTTGGTAGGCATCTTTCATAGACCCTGACCACTCCATAAT
CTTTTTAGCCCAATACATTCTTAAGTAGTTTGCCATAAACCCTGTAATACGTGCTTCTTT
CATCGCTGCATTAAAGTGTATATCATGGGTTTTACTAAATTCTATATCTTCTAAACTATA
GATATGTGTTCTTAAATCTCTTTCATGCTCATACATTGTTTCATATGCCCAAGACTCTGT
CATAAATTCAAACACATCATAATCTTTAATATATGTAACAAAGTTATACGCTAGAGACCT
TCTCACCACTAATTGTTCAATAAAACCTTCTGACATTTCAGGATAGATCTTATAGAATGG
ATGATCATAGAGCATACGCAATATTTCTTGATCGGATACTTGCCCGAATTGTAGATACAT
CGACATATAAGATTGAATATGTAGTGCAGGATCAGATCTTTTATCATAATCTTTAAGTAG
TTGGTTAAAGAAATATTCTAAATGTTTATAGGCTTCTTTTCTACCACCTTTAAATTTATG
ATATGGTTTCACACTCATATCAATTGGTAGGTTTTTTACTACTTCGTCTATGTTTGAAAG
ATCAAGTGGTTCATAGACTTTAGTCTTTTCAATATTATCTAACCTAGATAATTCTCTATA
ATCCATATATTGAGGTAATTTTTCCATCACTTTGGGTCTAATTACATAGGCACCATAAGC
AGCTTTTGGATAAAGTACTTCAACAGGTATGATAAGATCGGTTTCTACTTGAATAATATC
TATAGCATGTGTATCTTTAACGATTTTATAGACTTCATTTCTCATCTGTCTTTGAGGTTT
TAAATAGCCTCTATCCATAATGATGGTATCAACATCATCCAAATAAGGTTTGATGTTTTC
TGTTAGTTTACCAATACTTAATTCAAAGTGAATGTTTTCTTTAACGAAATCTTGTTGAAG
TTCTTTTAGACCCTCTAACATAAAGGTGTAGTGTCTAAGGTTCGCTTCAGGGTAGTTTGG
TAGTATGTTGAACCAGACAATTAACGGTAGTTTTTTCTTATTAGCAAGTTCAATCGCGTA
ATTTAAGGCATGGTTATACTGGATGCGCATGGATTGCTGCATCCAGTATAAAATGAATTT
ACCTTGTTTATTTGTGTTGTGTTCTAAAAACTTTTTAACTCGATCGTTATGTATCAT


>protein sequence
MIHNDRVKKFLEHNTNKQGKFILYWMQQSMRIQYNHALNYAIELANKKKLPLIVWFNILP
NYPEANLRHYTFMLEGLKELQQDFVKENIHFELSIGKLTENIKPYLDDVDTIIMDRGYLK
PQRQMRNEVYKIVKDTHAIDIIQVETDLIIPVEVLYPKAAYGAYVIRPKVMEKLPQYMDY
RELSRLDNIEKTKVYEPLDLSNIDEVVKNLPIDMSVKPYHKFKGGRKEAYKHLEYFFNQL
LKDYDKRSDPALHIQSYMSMYLQFGQVSDQEILRMLYDHPFYKIYPEMSEGFIEQLVVRR
SLAYNFVTYIKDYDVFEFMTESWAYETMYEHERDLRTHIYSLEDIEFSKTHDIHFNAAMK
EARITGFMANYLRMYWAKKIMEWSGSMKDAYQIIVYLNNKYFIDGRNPNSYGNIAWNFGK
HDRAWQERAIFGKLRYMNEQGLIRKFDMKTYLDYVNTL






















© Fisunov Lab of Proteomics, 2016.