ACL_RS07160


  Uniprot: A9NEW5
Description: ABC transporter substrate-binding protein
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 56,902
Subunit structure [CC]: 
Gene ontology (GO): 
Gene ontology IDs: 
Chain: CHAIN 19 523 {ECO:0000256|SAM:SignalP}. /FTId=PRO_5002741648.
Signal peptide: SIGNAL 1 18 {ECO:0000256|SAM:SignalP}.
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 34 105 DUF5011. {ECO:0000259|Pfam:PF16403}.
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: A9NEW5
MEROPS: 
EnsemblBacteria KO: ABX80895
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 
InterPro: 
PANTHER: IPR032179
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: 
ProDom: PF16403
SMART: 
SUPFAM: 
TIGRFAMs: 
276849-278421(+)

>nucleotide sequence
ATGAAAAAAATATTTAGCGTATTATTACTGTTAGTCGCAATGTTTGCTCTAGTAGCGTGT
GACAATACAGAAGGTAATGGTAACGATAAAAATTCAGCAACTATAACAGGTGCAGCGGAT
GTTACAATCAACGTCGGTGATGAGTTCGATCCGATGAACAATGTTAAAGCTGAAGATACA
GTAGATGGAAATATCACTACACGTATTCAAGTAAGTGGTACTGTACTTACAAATACAGCA
GGAACTTATACTTTAACTTATACAGTAGAAGGTTCTGATGGTAAAGTAACCACAGTAAAA
AGAGTTGTAACTGTAGTACAAAATCACACTACACCTCCAACAGAAATCGTAATTATGCAT
GGTGCGCCATATGAGGTTGACCCATTCGATGCTGCTTACTCTGGTAGAGAACAACAAGCA
AGACAAAATAAGCAAAGAGAAGTTGAATCAAGACTTAATGTTAAAGTGGTTTATAAGGCT
TACCCTGCGGCAGCTGCATGGGGACCAGACCGTATTAATGAAATAATTAAAGCATCAGTA
GCGGGAGCTCCGTTAGCGGATATCTTATGGACAACCTCTGACTGGACTGCTCAATTAGCT
AACGCGAATGCAATTGTTCCAGTTGACAAGTACTTAGAATCAACTGGTGCAAACATTACG
GAAGAAGCTCAACAACTAGGTAGATTTAAGAGTCAATTCTATGCATTCTCAGTAAACAAA
CCTACAGTTGACGTTGGTCTATACTTCAATATTGAGTTAGTTAATGACTTAGGTATTGAA
AATCCAGCCGAACTATACAATAACGGTGAGTGGACTTGGTCTAAATTTGAAGCTTGGTCA
GATGCCGCTAAAGCTGCACTTACAAGTATTGGACCTGATTATAAAGTCTTAGGTGGTGTA
CGTGCAGTATATGCTGAAAATATGATTCCATTAAATGGTGGTTCATTAATAAACGCATTA
TCTGGACGTGTTGCATTCCATCAAACAGCTGCATTAGAAACATATAGTTTCTTACATGGT
TTATATAATAAAGGTTTATTTGAAGGTTCAGGTACTTATGATTCAGGATCTCCATTATGG
CAATCAGGTAAAGTTGTAATGCACCCAGGTAGTTTCTGGTTCTTAAATGCAGAAAATAGA
TGGAAAAACTTAGCGTTTGACCTAGGATTTGTTCCTTATCCATCAAGTGATACATACACC
GGTAATTATGTTTCTCCAATCGGTGGTGTTGCAGTGTATACATTATCAAGTGGACTAACT
CCTGCTAAAGAAGCATTAGCATTCCAAGTATGGAATGAAATTCAAATGTGGAAGACAGAC
ACTGAATTTTCAGATGAATTCTACGCAACATTAGTACAAAGATTCAATGATGAAGCTTCG
ATTGATGCTTACCTAAGCATATTTGATAAAACAACATTAGATTTAACAGGTGCATTAGGT
ATCTCAAGATTCGCAGCAAATGGTTGGTACGGCGCAGCAAACCTTGCAATCGCTAATGGC
GATGCTAGAGGTGAGATGGACAAGATCAGACCTGCTTACGAAGACGCACTTGCATCATAT
TTAGGACAATAA


>protein sequence
MKKIFSVLLLLVAMFALVACDNTEGNGNDKNSATITGAADVTINVGDEFDPMNNVKAEDT
VDGNITTRIQVSGTVLTNTAGTYTLTYTVEGSDGKVTTVKRVVTVVQNHTTPPTEIVIMH
GAPYEVDPFDAAYSGREQQARQNKQREVESRLNVKVVYKAYPAAAAWGPDRINEIIKASV
AGAPLADILWTTSDWTAQLANANAIVPVDKYLESTGANITEEAQQLGRFKSQFYAFSVNK
PTVDVGLYFNIELVNDLGIENPAELYNNGEWTWSKFEAWSDAAKAALTSIGPDYKVLGGV
RAVYAENMIPLNGGSLINALSGRVAFHQTAALETYSFLHGLYNKGLFEGSGTYDSGSPLW
QSGKVVMHPGSFWFLNAENRWKNLAFDLGFVPYPSSDTYTGNYVSPIGGVAVYTLSSGLT
PAKEALAFQVWNEIQMWKTDTEFSDEFYATLVQRFNDEASIDAYLSIFDKTTLDLTGALG
ISRFAANGWYGAANLAIANGDARGEMDKIRPAYEDALASYLGQ






















© Fisunov Lab of Proteomics, 2016.