ACL_RS07320


  Uniprot: A9NHB7
Description: zinc metalloprotease
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: 
Cofactor: COFACTOR: Name=Zn(2+); Xref=ChEBI:CHEBI:29105; Evidence={ECO:0000256|SAAS:SAAS00610815};
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 56,369
Subunit structure [CC]: 
Gene ontology (GO): integral component of membrane [GO:0016021]; plasma membrane [GO:0005886]; metal ion binding [GO:0046872]; metalloendopeptidase activity [GO:0004222]
Gene ontology IDs: GO:0004222; GO:0005886; GO:0016021; GO:0046872
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the peptidase M50B family. {ECO:0000256|SAAS:SAAS00563376}.
Protein families: Peptidase M50B family
Coiled coil: 
Domain [FT]: DOMAIN 195 263 PDZ (DHR). {ECO:0000259|SMART:SM00228}.; DOMAIN 277 347 PDZ (DHR). {ECO:0000259|SMART:SM00228}.
Motif: 
Region: 
EMBL: CP000896
ProteinModelPortal: A9NHB7
MEROPS: 
EnsemblBacteria KO: ABX81747
UniPathway: K11749
CDD: 
Gene3D: 
HAMAP: 2.30.42.10
InterPro: 
PANTHER: IPR001478;IPR004387;IPR008915
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: 
ProDom: PF02163
SMART: 
SUPFAM: SM00228
TIGRFAMs: SSF50156
1205513-1207061(-)

>nucleotide sequence
TTATGTAAAAATTCTTAAAATGTCATTCCAAGTTACAAATACAAAGAGCATTAATAACAG
TATAAAGAATGCATTATTGACAAGTCCTTCAACTTTAGCGGGAATTTTCTTTTTAGAAAC
TGCTTCGTATCCTAAGAATAATAAGCGACCACCGTCTAAAGCTGGAATTGGAAGTAAATT
CATCAGTCCAATATTTACAGATAAGAAGGCTACAAATCCTAATAGGTTAATGAAACCACC
TTGTGCTGCATTAGATACTAAACTAAATATACCGACTGGACCTGCAAGATCTGAAACACC
CACACCACTAGAGGCACTAAATAACATACCAATAGTGTTTACCATTTCAGTAACTGAACC
ACCAAATCTTTGGAACGGATTATATAATATATATAAGAAGTCAAATTCATAACCTGTTTG
AAATCCAAAACGTACGGCTATACTTTCATGACCTAACTTATTTAATGTATCTTCAGGTAA
CACATCATATGTAAAAGTTAAGTATTCTCCATCACGTAAAACGTTTAATGTAATAGTTGT
TTCATTATAGTTTCTGGCAAGCACTAAAATATCTGACCAATTCGATACAGGTATCCCATT
AACTTGTGTGATTTCATCACCTAAGTTTACACCTGCACTACTTGCTTTACCACCGATACC
ACCAATAAATGCACCGTCTTTATACGCATCTGTTGTATCATTGACTAAACCAAAATTTTG
TAAAAGAATCGTCACATATAGATCAATAGATTCTTCAACACCGTTTCTAACGACTACTAC
TGGTACAACATGATCTGTGATCAGTGCGCCCATTTGTCTAATGTCATCTAAGTCTTCGAC
ATCTGTACCATCAATATTGACAATAATATCACCTGCAATTAAACCGGGATTTGATGATTC
ATGTACAACATTATCATCTACTGGTTTACCTTGAACAGCTGCAATAATAATAAATAGTAA
TAGGGCTAAGATAAAGTTCATCATTGGTCCCATAAATAATACTAAGAAACGTTGCCAAAT
TGTCTTAGATGCAAAAGATGATTCTTCTGGTGTGATCTGTAATTCTTTTTCTTTACCATA
ATAATATTTAGCATCACGGGTCACTTGATATCGTAATACTTCACCTTCATCGGTTTTAAT
TTCAATGAAAAGTTCACTTAAGTTTTTACCATATAAATCAAAATCAACAACTTCACCTGT
AACAAGTGGTTTTTTTCTAGTTTGATCTAATAAAATACCTGTAACTAAACCTATCTCATT
TAAACATATACCCACTCTAGAGCCTTTTGAGATTAAAGCATAATCCCCATTTTCTCCACT
CATAGATACATAGCCACCTAAAGGTATAGCTCTAAAGGCATACTTTGTATCACCTTTAGT
TTTTGCAACAATTTGAGGTCCCATACCAATTGAAAACTCATGTATGAGAATACCAGCTCT
TTTCGCGAATAAGAAATGTCCTAATTCGTGAATTGAGATGATTACTGTTAAAACTAATAA
AAATAATATTAAGTTAGTCAATATACTAACAAGTTGTGAAAAATCCAT


>protein sequence
MDFSQLVSILTNLILFLLVLTVIISIHELGHFLFAKRAGILIHEFSIGMGPQIVAKTKGD
TKYAFRAIPLGGYVSMSGENGDYALISKGSRVGICLNEIGLVTGILLDQTRKKPLVTGEV
VDFDLYGKNLSELFIEIKTDEGEVLRYQVTRDAKYYYGKEKELQITPEESSFASKTIWQR
FLVLFMGPMMNFILALLLFIIIAAVQGKPVDDNVVHESSNPGLIAGDIIVNIDGTDVEDL
DDIRQMGALITDHVVPVVVVRNGVEESIDLYVTILLQNFGLVNDTTDAYKDGAFIGGIGG
KASSAGVNLGDEITQVNGIPVSNWSDILVLARNYNETTITLNVLRDGEYLTFTYDVLPED
TLNKLGHESIAVRFGFQTGYEFDFLYILYNPFQRFGGSVTEMVNTIGMLFSASSGVGVSD
LAGPVGIFSLVSNAAQGGFINLLGFVAFLSVNIGLMNLLPIPALDGGRLLFLGYEAVSKK
KIPAKVEGLVNNAFFILLLMLFVFVTWNDILRIFT






















© Fisunov Lab of Proteomics, 2016.