GCW_00290
![]() ![]() ![]() |
Uniprot: A0A0F6CJV6
Description: 50S ribosomal protein L23 EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: One of the early assembly proteins it binds 23S rRNA. One of the proteins that surrounds the polypeptide exit tunnel on the outside of the ribosome. Forms the main docking site for trigger factor binding to the ribosome. {ECO:0000256|HAMAP-Rule:MF_01369}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): rplW Gene names (synonym): Mass: 12,029 Subunit structure [CC]: SUBUNIT: Part of the 50S ribosomal subunit. Contacts protein L29, and trigger factor when it is bound to the ribosome. {ECO:0000256|HAMAP-Rule:MF_01369}. Gene ontology (GO): ribosome [GO:0005840]; nucleotide binding [GO:0000166]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412] Gene ontology IDs: GO:0000166; GO:0003735; GO:0005840; GO:0006412; GO:0019843 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ribosomal protein L23P family. {ECO:0000256|HAMAP-Rule:MF_01369}. Protein families: Ribosomal protein L23P family Coiled coil: Domain [FT]: Motif: Region: EMBL: CP006916 ProteinModelPortal: MEROPS: EnsemblBacteria KO: AHB99378 UniPathway: K02892 CDD: Gene3D: HAMAP: 3.30.70.330 InterPro: MF_01369_B PANTHER: IPR012677;IPR012678;IPR013025 PIRSF: PRINTS: PROSITE: Pfam: ProDom: PF00276 SMART: SUPFAM: TIGRFAMs: SSF54189 69424-69751(+) >nucleotide sequence ATGTCAGAACCAAGGAAGTACACTTTCTTAGTTAATGCCAAAGCCAATAAGAATTACATT AAGCAAGCTTTCAAAGCAATTTATGGAGTGACTCCAATAGCTGTTAATACAAAGATTAAA AAACCAGCTAGAGTTCGCACAGGAACACAAAACCCAGGTTATTCAAGACTGGAAAAGATT GCAATCATCACTGTTCCGTTCGGAGCGGAAGTAGCAATCACTGGAGAAAAACCAGAACCA AAAGAAGAATCATCTTCTAAAAAATAA >protein sequence KPARVRTGTQNPGYSRLEKIAIITVPFGAEVAITGEKPEPKEESSSKK |
© Fisunov Lab of Proteomics, 2016.