GCW_00330







Uniprot: A0A0F6CJW4
Description: 50S ribosomal protein L14
EC number: 
Annotation score: 2 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: FUNCTION: Binds to 23S rRNA. Forms part of two intersubunit bridges in the 70S ribosome. {ECO:0000256|HAMAP-Rule:MF_01367, ECO:0000256|RuleBase:RU003950}.
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): rplN
Gene names (synonym): 
Mass: 13,583
Subunit structure [CC]: SUBUNIT: Part of the 50S ribosomal subunit. Forms a cluster with proteins L3 and L19. In the 70S ribosome, L14 and L19 interact and together make contacts with the 16S rRNA in bridges B5 and B8. {ECO:0000256|HAMAP-Rule:MF_01367}.
Gene ontology (GO): large ribosomal subunit [GO:0015934]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]
Gene ontology IDs: GO:0003735; GO:0006412; GO:0015934; GO:0019843
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the ribosomal protein L14P family. {ECO:0000256|HAMAP-Rule:MF_01367, ECO:0000256|RuleBase:RU003949}.
Protein families: Ribosomal protein L14P family
Coiled coil: 
Domain [FT]: 
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: A0A0F6CJW4
MEROPS: 
EnsemblBacteria KO: AHB99386
UniPathway: K02874
CDD: 
Gene3D: 
HAMAP: 2.40.150.20
InterPro: MF_01367
PANTHER: IPR000218;IPR005745;IPR019972
PIRSF: PTHR11761
PRINTS: 
PROSITE: 
Pfam: PS00049
ProDom: PF00238
SMART: 
SUPFAM: SM01374
TIGRFAMs: SSF50193
73345-73720(+)

>nucleotide sequence
ATGATTCAATTTATGACAAGACTTAACGTCGCTGATAATACCGGTGCGCGTGAAGTTGGT
GTAATTAAGGTATTAAACGGTTCTAAAAGAAGATATGCTTCTGTTGGTGATATTGTTGTT
GTATCAGTAAAAGACGCAATCCCTTCAGGGACAGTAAAAAAAGGTCAAGTATTATTTGCT
GTGATCGTAAGAACTAAAAAAGGTGCGCAAAGAAGAGATGGAACTCACCTAGCATTTGAT
GATAATGCTTGTGTAATTATTAAGAACCGTGAAGATTTTGCTCCAAGAGGAACACGGATC
TTTGGACCAGTAGCGCGTGAGTTAAGAGATAAAGGATTTAACCGGATCGTTTCTTTAGCA
AGCGAAGTGTTATAG


>protein sequence
MIQFMTRLNVADNTGAREVGVIKVLNGSKRRYASVGDIVVVSVKDAIPSGTVKKGQVLFA
VIVRTKKGAQRRDGTHLAFDDNACVIIKNREDFAPRGTRIFGPVARELRDKGFNRIVSLA
SEVL






















© Fisunov Lab of Proteomics, 2016.