GCW_00335
![]() ![]() ![]() |
Uniprot: A0A0F6CJW5
Description: 50S ribosomal protein L24 EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: One of the proteins that surrounds the polypeptide exit tunnel on the outside of the subunit. {ECO:0000256|HAMAP-Rule:MF_01326}.; FUNCTION: One of two assembly initiator proteins, it binds directly to the 5'-end of the 23S rRNA, where it nucleates assembly of the 50S subunit. {ECO:0000256|HAMAP-Rule:MF_01326}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): rplX Gene names (synonym): Mass: 12,224 Subunit structure [CC]: SUBUNIT: Part of the 50S ribosomal subunit. {ECO:0000256|HAMAP-Rule:MF_01326}. Gene ontology (GO): ribosome [GO:0005840]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412] Gene ontology IDs: GO:0003735; GO:0005840; GO:0006412; GO:0019843 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ribosomal protein L24P family. {ECO:0000256|HAMAP-Rule:MF_01326, ECO:0000256|RuleBase:RU003477}. Protein families: Ribosomal protein L24P family Coiled coil: Domain [FT]: DOMAIN 3 30 KOW. {ECO:0000259|SMART:SM00739}. Motif: Region: EMBL: CP006916 ProteinModelPortal: A0A0F6CJW5 MEROPS: EnsemblBacteria KO: AHB99387 UniPathway: K02895 CDD: Gene3D: HAMAP: 2.30.30.30 InterPro: MF_01326_B PANTHER: IPR005824;IPR014722;IPR003256;IPR005825;IPR008991 PIRSF: PRINTS: PROSITE: Pfam: PS01108 ProDom: PF00467;PF17136 SMART: SUPFAM: SM00739 TIGRFAMs: SSF50104 73730-74060(+) >nucleotide sequence ACGGGGATCGTTTTACAAGTATTTGTTAAAGAACAACGCGCAATCGTTGAAGGAATAAAT ATGGTGAAACGCCACACCAAAGAAAACGCCCAAAATCAAAAAGGTGGGATTATTGAAAAA GAAGCACCAATCCACCTATCTAACCTTGCTTTATTAGATCATAAAGCTAAAGATGTAAGA CCAGTTAAAGTTAAATATGGAACTGATCCAAAAACCAATAAAAAAGTGCGTTTATCTCGC AAAACAAATAATCTTGTAGGTGGTCAATAA >protein sequence EAPIHLSNLALLDHKAKDVRPVKVKYGTDPKTNKKVRLSRKTNNLVGGQ |
© Fisunov Lab of Proteomics, 2016.