GCW_00340
![]() ![]() ![]() |
Uniprot: A0A0F6CJW6
Description: 50S ribosomal protein L5 EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: This is 1 of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. In the 70S ribosome it contacts protein S13 of the 30S subunit (bridge B1b), connecting the 2 subunits; this bridge is implicated in subunit movement. Contacts the P site tRNA; the 5S rRNA and some of its associated proteins might help stabilize positioning of ribosome-bound tRNAs. {ECO:0000256|HAMAP-Rule:MF_01333}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): rplE Gene names (synonym): Mass: 20,797 Subunit structure [CC]: SUBUNIT: Part of the 50S ribosomal subunit; part of the 5S rRNA/L5/L18/L25 subcomplex. Contacts the 5S rRNA and the P site tRNA. Forms a bridge to the 30S subunit in the 70S ribosome. {ECO:0000256|HAMAP-Rule:MF_01333}. Gene ontology (GO): ribosome [GO:0005840]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; tRNA binding [GO:0000049]; translation [GO:0006412] Gene ontology IDs: GO:0000049; GO:0003735; GO:0005840; GO:0006412; GO:0019843 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ribosomal protein L5P family. {ECO:0000256|HAMAP-Rule:MF_01333, ECO:0000256|RuleBase:RU003930}. Protein families: Ribosomal protein L5P family Coiled coil: Domain [FT]: DOMAIN 23 79 Ribosomal_L5. {ECO:0000259|Pfam:PF00281}.; DOMAIN 84 175 Ribosomal_L5_C. {ECO:0000259|Pfam:PF00673}. Motif: Region: EMBL: CP006916 ProteinModelPortal: A0A0F6CJW6 MEROPS: EnsemblBacteria KO: AHB99388 UniPathway: K02931 CDD: Gene3D: HAMAP: 3.30.1440.10 InterPro: MF_01333_B PANTHER: IPR002132;IPR020930;IPR031309;IPR020929;IPR022803;IPR031310 PIRSF: PRINTS: PIRSF002161 PROSITE: Pfam: PS00358 ProDom: PF00281;PF00673 SMART: SUPFAM: TIGRFAMs: SSF55282 74059-74617(+) >nucleotide sequence TTTTCTTCAGTAATGCAAGTTCCTAAGATCGAAAAGATCGTGATCAACATGGGTGTAGGT GATGCTACTAAAGATGCAAAACTATTAGAATTAGCACAAGCTGAATTGCAAGCAATTAGT GGACAAAAACCAGTCATTACTAAAGCACACTCTTCAAACGCTTCTTTCAAAATTAGACAA GGTCAAGCAATTGGTTGTAAAGTAACTCTAAGAGGTGAAAAGATGTGAAACTTTTTAGAA AAACTAATTAACATTGCCCTACCACGTGTAAGAGACTTCAGAGGTTTATCAAACCGCGCA TTTGATGCTAGAGGGAATTACACTCTAGGAATTAAAGAGCAGATCATCTTCCCAGAAATT ATCTATGATAATGTGAAGAAAATTCGTGGATTCGACGTTACGTTAGTAATTTCATCTGAT AATGCTAAATACAATCACCGTCTTTTATTAGAATTAGGAATGCCTTTAATTAAGACTAAG GAACACGCAAATGGCTAA >protein sequence GQKPVITKAHSSNASFKIRQGQAIGCKVTLRGEKMWNFLEKLINIALPRVRDFRGLSNRA FDARGNYTLGIKEQIIFPEIIYDNVKKIRGFDVTLVISSDNAKYNHRLLLELGMPLIKTK EHANG |
© Fisunov Lab of Proteomics, 2016.