GCW_00350
![]() ![]() ![]() |
Uniprot: A0A0F6CJW8
Description: 30S ribosomal protein S8 EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: One of the primary rRNA binding proteins, it binds directly to 16S rRNA central domain where it helps coordinate assembly of the platform of the 30S subunit. {ECO:0000256|HAMAP-Rule:MF_01302}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): rpsH Gene names (synonym): Mass: 14,839 Subunit structure [CC]: SUBUNIT: Part of the 30S ribosomal subunit. Contacts proteins S5 and S12. {ECO:0000256|HAMAP-Rule:MF_01302}. Gene ontology (GO): ribosome [GO:0005840]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412] Gene ontology IDs: GO:0003735; GO:0005840; GO:0006412; GO:0019843 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ribosomal protein S8P family. {ECO:0000256|HAMAP-Rule:MF_01302, ECO:0000256|RuleBase:RU003660}. Protein families: Ribosomal protein S8P family Coiled coil: Domain [FT]: Motif: Region: EMBL: CP006916 ProteinModelPortal: A0A0F6CJW8 MEROPS: EnsemblBacteria KO: AHB99390 UniPathway: K02994 CDD: Gene3D: HAMAP: InterPro: MF_01302_B PANTHER: IPR000630 PIRSF: PTHR11758 PRINTS: PROSITE: Pfam: PS00053 ProDom: PF00410 SMART: SUPFAM: TIGRFAMs: SSF56047 74818-75220(+) >nucleotide sequence ATTGTTGAGTTACAAACCGAAGCTTCTAAACTAAAGGTTGCGATTTTAAACATCTTGCTT AATGAAGGCTACATTCGCGGTTATGAGATCTATGACAATAAAGAAAAAACAAAATCAATT TTAAAGATCAAACTTAAGTTTGACGAAAACCGCGTTAGTTCACTAAACGGAATAAAACAA ATTTCTAAACCTGGTTTAAGAATTTATGTTTCAGCAGAAAAATTACCGAAAGTTTTAAAC GGTTTAGGAATCGCAATTGTTTCAACAAACGAAGGTTTAATGACTGATAAATTAGCAAGA GCCAAGAAGATCGGTGGCGAAGTACTTGCTTATGTTTGATAG >protein sequence LKIKLKFDENRVSSLNGIKQISKPGLRIYVSAEKLPKVLNGLGIAIVSTNEGLMTDKLAR AKKIGGEVLAYVW |
© Fisunov Lab of Proteomics, 2016.