GCW_00360
![]() ![]() ![]() |
Uniprot: A0A0F6CJX0
Description: 50S ribosomal protein L18 EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: This is one of the proteins that binds and probably mediates the attachment of the 5S RNA into the large ribosomal subunit, where it forms part of the central protuberance. {ECO:0000256|HAMAP-Rule:MF_01337}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): rplR Gene names (synonym): Mass: 13,454 Subunit structure [CC]: SUBUNIT: Part of the 50S ribosomal subunit; part of the 5S rRNA/L5/L18/L25 subcomplex. Contacts the 5S and 23S rRNAs. {ECO:0000256|HAMAP-Rule:MF_01337}. Gene ontology (GO): ribosome [GO:0005840]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412] Gene ontology IDs: GO:0003735; GO:0005840; GO:0006412; GO:0019843 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ribosomal protein L18P family. {ECO:0000256|HAMAP-Rule:MF_01337}. Protein families: Ribosomal protein L18P family Coiled coil: Domain [FT]: Motif: Region: EMBL: CP006916 ProteinModelPortal: MEROPS: EnsemblBacteria KO: AHB99392 UniPathway: K02881 CDD: Gene3D: HAMAP: InterPro: MF_01337_B PANTHER: IPR005484;IPR004389 PIRSF: PRINTS: PROSITE: Pfam: ProDom: PF00861 SMART: SUPFAM: TIGRFAMs: 75796-76156(+) >nucleotide sequence AAAAAAATTCGCAGAATTGACAATGATCGTCCAGTAATGATCGTGGTTAAATCAAACAGC CACATCTCAGCACAAGTGTGAGATTTTAACCAAAACAAGATCATTGCTTCAAGCTCTTCT GTTAGTTTAGATCTGGTTAACGGAAATAAAGAAAATGCGGCTATTGTTGGTACTGATATT GCCAATAAGCTACTAAAAATGAAGATTGATGAGATCACCTTTGATCACGGTGGTTCAAAA TACCATGGCCGAATTGCTGCACTTGCAGACGCTGCAAGAAAAGCTGGTTTAAAATTCTAG >protein sequence VSLDLVNGNKENAAIVGTDIANKLLKMKIDEITFDHGGSKYHGRIAALADAARKAGLKF |
© Fisunov Lab of Proteomics, 2016.