GCW_00375







Uniprot: A0A0F6CJX3
Description: preprotein translocase subunit SecY
EC number: 
Annotation score: 2 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: FUNCTION: The central subunit of the protein translocation channel SecYEG. Consists of two halves formed by TMs 1-5 and 6-10. These two domains form a lateral gate at the front which open onto the bilayer between TMs 2 and 7, and are clamped together by SecE at the back. The channel is closed by both a pore ring composed of hydrophobic SecY resides and a short helix (helix 2A) on the extracellular side of the membrane which forms a plug. The plug probably moves laterally to allow the channel to open. The ring and the pore may move independently. {ECO:0000256|HAMAP-Rule:MF_01465, ECO:0000256|RuleBase:RU000537}.
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): secY
Gene names (synonym): 
Mass: 55,101
Subunit structure [CC]: SUBUNIT: Component of the Sec protein translocase complex. Heterotrimer consisting of SecY, SecE and SecG subunits. The heterotrimers can form oligomers, although 1 heterotrimer is thought to be able to translocate proteins. Interacts with the ribosome. Interacts with SecDF, and other proteins may be involved. Interacts with SecA. {ECO:0000256|HAMAP-Rule:MF_01465}.
Gene ontology (GO): integral component of membrane [GO:0016021]; intracellular [GO:0005622]; plasma membrane [GO:0005886]; intracellular protein transmembrane transport [GO:0065002]; protein targeting [GO:0006605]; protein transport by the Sec complex [GO:0043952]
Gene ontology IDs: GO:0005622; GO:0005886; GO:0006605; GO:0016021; GO:0043952; GO:0065002
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the SecY/SEC61-alpha family. {ECO:0000256|HAMAP-Rule:MF_01465, ECO:0000256|RuleBase:RU004349}.
Protein families: SecY/SEC61-alpha family
Coiled coil: 
Domain [FT]: 
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: AHB99395
UniPathway: K03076
CDD: 
Gene3D: 
HAMAP: 1.10.3370.10
InterPro: MF_01465
PANTHER: IPR026593;IPR002208;IPR030659;IPR023201
PIRSF: PTHR10906
PRINTS: PIRSF004557
PROSITE: 
Pfam: PS00755;PS00756
ProDom: PF00344
SMART: 
SUPFAM: 
TIGRFAMs: SSF103491

In one protein complex with GCW_03635 GCW_02630 77306-78803(+)

>nucleotide sequence
ATGGCAAAAACTAACTCAAAAAATCTTTTAGGTCAAAGAATTATCAAGTTGTTAAGAAAC
AGAGATTTCGTAATCTCTGTTTTTGTCACACTGTTCTTGATTTTGTTATTTAGAGTGATC
AGTGTTATTCCTTTACCTGGAATTACGATCAGTCAAAACAAGAATAATCTGAACAACGGT
GTGAGTGACTTTTTTGACCTATTTAATTTATTAGGTGGTGGTGGTTTAAGTCAATTGTCA
CTGTTTGCAGTGGGGATTTCACCATACATCTCGGCACAAATTATTATGCAGTTGTTATCA
ACTGACTTAATTCCCCCACTAAGTAAGTTAGCAAAATCGGGTGAATTGGGCCGAAGAAGA
ATCGAATTGATTACCCGCTTTGTAACCTTACCGTTTGCAGTAGTTCAAGCATTTGCCATT
ATCGCTTTAATCAATAACCAAAGAAACGGAGCAATCCGTTTTGAAAATGGTGGTATCTTA
CATCAAGCGTTTTATATCGTAACGATGACAGCTGGTACGTATATTGGGATCTTTATTGGG
GATATTATCTCTAAAAAAGGTGTTGGTAATGGGATTACGTTATTGATTCTTTCAGGGATT
CTAGCAAGATTACCAGATGGATTCATCGTTATGTACCGAGTTTTAGGTGGGGTGATTATT
AGTACTAACCCGATCTTAACTTCAGCTATCAACTTCAGCTTGTACTTCTTAGCCTTCTTG
GTCTTATTGTTAGCAATCACTTTTGTCAACTCATCAACAAGAAGGATCCCGATCCAACAA
ACCGGTGAAGGGATGGTATTAGGTAATGAAAAATTACCGTACTTACCAATTAAACTAAAT
GCTGCTGGGGTAATCCCCGTCATCTTTGCTTCATCAATTATGTCAATTCCGATTACGATT
GCTGAGTTCCAACCACAATCTGAAGCAAGATGATTTGTTGAAGATTACTTATCACTAAGA
ACTCCTGTAGGGATTAGCTTATATGTGGTTTTAATCATCATCTTCACATTCTTTTATAGT
TATATTCAGATCAACCCAGAACAACTTGCTGAGAATTTCAATAAGTCGCACAAATTTATT
CCTGGGGTAAGACCAGGATTAGATACAGAAAAACACATCACTAAAGTGTTAATGCGTATT
AATTTTATTGGTGCACCATTCTTAGCAATTGTAGCTGTAATTCCTTATATTATCTCGCTA
GTACTTAACGTACCAACCACCTTATCGCTTGGTGGTACGGGGATCATCATCATGGTCTCT
GCTAGTATGGAGCTGTATCGTTCACTAAGATCAGCAGCAACAACAACATCATACCAACGG
TTACGCAAAGATATTGCCAACCGAATTGAAGTTGAACTATCATTAAATGATTATATGAAT
AAACCAAATCTTGAACACGATCAATATGGTTTATTAGGTAAACATAAAAAAGTTGAACCA
ACTCAAGATAAAAAGAAAAATCCAAGTGATCCATTAGAGGTGAGCCAACTGTGATAA


>protein sequence
MAKTNSKNLLGQRIIKLLRNRDFVISVFVTLFLILLFRVISVIPLPGITISQNKNNLNNG
VSDFFDLFNLLGGGGLSQLSLFAVGISPYISAQIIMQLLSTDLIPPLSKLAKSGELGRRR
IELITRFVTLPFAVVQAFAIIALINNQRNGAIRFENGGILHQAFYIVTMTAGTYIGIFIG
DIISKKGVGNGITLLILSGILARLPDGFIVMYRVLGGVIISTNPILTSAINFSLYFLAFL
VLLLAITFVNSSTRRIPIQQTGEGMVLGNEKLPYLPIKLNAAGVIPVIFASSIMSIPITI
AEFQPQSEARWFVEDYLSLRTPVGISLYVVLIIIFTFFYSYIQINPEQLAENFNKSHKFI
PGVRPGLDTEKHITKVLMRINFIGAPFLAIVAVIPYIISLVLNVPTTLSLGGTGIIIMVS
ASMELYRSLRSAATTTSYQRLRKDIANRIEVELSLNDYMNKPNLEHDQYGLLGKHKKVEP
TQDKKKNPSDPLEVSQLW






















© Fisunov Lab of Proteomics, 2016.