GCW_00415







Uniprot: A0A0F6CJX9
Description: molecular chaperone DnaJ
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): dnaJ
Gene names (synonym): 
Mass: 42,943
Subunit structure [CC]: 
Gene ontology (GO): integral component of membrane [GO:0016021]
Gene ontology IDs: GO:0016021
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: COILED 301 328 {ECO:0000256|SAM:Coils}.
Domain [FT]: DOMAIN 9 73 J. {ECO:0000259|PROSITE:PS50076}.; DOMAIN 144 207 J. {ECO:0000259|PROSITE:PS50076}.
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: AHB99401
UniPathway: 
CDD: 
Gene3D: cd06257
HAMAP: 1.10.287.110
InterPro: 
PANTHER: IPR001623;IPR018253
PIRSF: 
PRINTS: 
PROSITE: PR00625
Pfam: PS00636;PS50076
ProDom: PF00226
SMART: 
SUPFAM: SM00271
TIGRFAMs: SSF46565
89900-91031(+)

>nucleotide sequence
TTGAGGTGGTTAGTGAAAGAACAAAATTATTATGAAATATTAGGTGTCAGCACTAAGGCT
TCTTCAAGTGATATTAAAAAAGCGTTCAGAAAACTTGCAAAAAAATACCACCCTGATGTC
AATAGTGACCCCCAATCACTCGAACTGTTTCAAAAGATTAACGAAGCTTATGAAGTTTTA
AGTGACGAGAAAGCACGTAGGGACTACGATGAGTTCGAATTAGATCTTTATGACAGTGAT
GATGATGTAGATGATTGAACTGAGTTTGTCGATACTAAAGATGTCTTTAGTAAGATTTTT
ACAAACATCAAAAGCAATCAGCAGACAACTTCAAAAGCCAATAAACCACCTTTTAGTTCT
CAAGCTAGCAACACACCACCTTCTAGTTCAAATAAAACTACCACCAAAACAGACCCTAAT
ACACCTAAAAATTTATACACAATTTTAGGGGCAAATAAAAAAACCTCTGTTGACGAATTA
AAACGGTTGTACAGTATTTTGAAATTAAAATACTCAACCAATCCAAAGACAGAAGCTAAC
GAATGGTTAAAAAAAGAGATCCAATGTGCTTATACGGTTTTATCTAACCGTGAAAGCAAG
GCTAAATACGATAAAACCGGGATCTTTAGCTTTGAAGGTGTGAGCCACCTAGGTGGCGTT
TTTTCACGTACTAGACACTTACAAGAATTAGAAAAACGCCAGAAAAAATCTAAAGCAACA
ACCCAATCAACAGGTACCCGTAAGGTTAATAACAAGAAGAGTTCAATCCACAACGTGCCT
TATAGTAGTCCTAAGGACCGTTATGCTTCCTTTACTAAATTTAGCACCCCACAAGCGCAA
AAAAAATCTGCTTGACAAGCTGCTAAATTCGACATTAATATTGAAGATTACTATACCAAT
GTTAATATTGCAGACGATGAACTACTTTCACTACGCGAAGAAGTGTTAGAACAAAAGAAA
AATAAGGAAGAAAAACACAACCAAGATCCTAATGCTAAAAAACAAACAGGTTTAGCTAGA
TTTAAAGAAAATCGCCCAATCTTAAGTTCGGTTATTACTGGTCTATTGATTTCGGTTATT
TTAACGGTTATTATCGTTGTTATTATCGCTAAAACTGGTATAACTAAGTAA


>protein sequence
LRWLVKEQNYYEILGVSTKASSSDIKKAFRKLAKKYHPDVNSDPQSLELFQKINEAYEVL
SDEKARRDYDEFELDLYDSDDDVDDWTEFVDTKDVFSKIFTNIKSNQQTTSKANKPPFSS
QASNTPPSSSNKTTTKTDPNTPKNLYTILGANKKTSVDELKRLYSILKLKYSTNPKTEAN
EWLKKEIQCAYTVLSNRESKAKYDKTGIFSFEGVSHLGGVFSRTRHLQELEKRQKKSKAT
TQSTGTRKVNNKKSSIHNVPYSSPKDRYASFTKFSTPQAQKKSAWQAAKFDINIEDYYTN
VNIADDELLSLREEVLEQKKNKEEKHNQDPNAKKQTGLARFKENRPILSSVITGLLISVI
LTVIIVVIIAKTGITK






















© Fisunov Lab of Proteomics, 2016.