GCW_00810







Uniprot: A0A0F6CK37
Description: histone-like DNA-binding superfamily protein
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): hup_1
Gene names (synonym): 
Mass: 13,932
Subunit structure [CC]: 
Gene ontology (GO): DNA binding [GO:0003677]
Gene ontology IDs: GO:0003677
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the bacterial histone-like protein family. {ECO:0000256|RuleBase:RU003939, ECO:0000256|SAAS:SAAS00560676}.
Protein families: Bacterial histone-like protein family
Coiled coil: 
Domain [FT]: 
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: AHB99459
UniPathway: K03530
CDD: 
Gene3D: 
HAMAP: 4.10.520.10
InterPro: 
PANTHER: IPR000119;IPR010992
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: 
ProDom: PF00216
SMART: 
SUPFAM: SM00411
TIGRFAMs: SSF47729
184780-185152(-)

>nucleotide sequence
TTACTCTTCGTCGTTCTGGCGGTTCTTAAAGAATCCAGCGGCTTTTCTTTTAGGTTGAAG
TAATTCATCGTCTTCGCTTACGTATTTCCACTTGATTGTAGCTGTTACTTCTTTAAGTGG
TTTAGCAGCTCTAAATTTTACTTTTGGTTTAGGCGGAATTCTAGTTTGTGCTCCTGTAAT
CGGGTTAACTGAAATTCTTTCACGACCAATAGTAACTCTAAAAGTACCAAGTTCAGGTAA
TCTTACTTGACCTTGAGATTTAATTTCTTTTTTTACTAAATCACTATAAACTTGGAAACA
AGCCTTAACAAGTTTTGGACTTACTCCAGTACATTCAGCGATAATTTTGCAAATTTCAGA
TTTAGTTAGCAT


>protein sequence
MLTKSEICKIIAECTGVSPKLVKACFQVYSDLVKKEIKSQGQVRLPELGTFRVTIGRERI
SVNPITGAQTRIPPKPKVKFRAAKPLKEVTATIKWKYVSEDDELLQPKRKAAGFFKNRQN
DEE






















© Fisunov Lab of Proteomics, 2016.