GCW_00825
![]() ![]() ![]() |
Uniprot: A0A0F6CK40
Description: 50S ribosomal protein L10 EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: Forms part of the ribosomal stalk, playing a central role in the interaction of the ribosome with GTP-bound translation factors. {ECO:0000256|HAMAP-Rule:MF_00362}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): rplJ Gene names (synonym): Mass: 18,184 Subunit structure [CC]: SUBUNIT: Part of the ribosomal stalk of the 50S ribosomal subunit. The N-terminus interacts with L11 and the large rRNA to form the base of the stalk. The C-terminus forms an elongated spine to which L12 dimers bind in a sequential fashion forming a multimeric L10(L12)X complex. {ECO:0000256|HAMAP-Rule:MF_00362}. Gene ontology (GO): ribosome [GO:0005840]; large ribosomal subunit rRNA binding [GO:0070180]; ribosome biogenesis [GO:0042254]; translation [GO:0006412] Gene ontology IDs: GO:0005840; GO:0006412; GO:0042254; GO:0070180 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ribosomal protein L10P family. {ECO:0000256|HAMAP-Rule:MF_00362}. Protein families: Ribosomal protein L10P family Coiled coil: Domain [FT]: Motif: Region: EMBL: CP006916 ProteinModelPortal: MEROPS: EnsemblBacteria KO: AHB99462 UniPathway: K02864 CDD: Gene3D: HAMAP: InterPro: MF_00362 PANTHER: IPR022973;IPR001790 PIRSF: PRINTS: PROSITE: Pfam: ProDom: PF00466 SMART: SUPFAM: TIGRFAMs: In one protein complex with GCW_00830 186143-186635(+) >nucleotide sequence GAAGCGAAATCGTTTGTCGTATTTGAATATTCAACAATGACAGCAAAAGCTATTACAGCA CTTAGAAGAAAAGTAAAAACTAGTGCTAATCAGATGTTTGTTTTAAAAAACAACATCTTA AAAAGAGCAATTAAAGAAGCTGGCATTGATGGATTTGACGATGATATCAAAAACCAAATC GCAGTTGTGATTGGGTTAGAAGACGCTTTTTTACCGATCAAAGCAGTTCATGAATATGTT ACAGCTAATGAAAAAGTTAAGTATGTTTGCGGATATTTAGAAAACAAGAAATTATCTGCA GCAGAACTAAGCGAAATAGCTGTTCTTCCATCAAGAGATGAACTATACAGCATGTTCTTA TCAGTGCTTCAAGCTCCAGTAGGCAAATTTATGTACGCGCTTAAAGCTGTAGCTGATACA AAACAACAATAA >protein sequence KRAIKEAGIDGFDDDIKNQIAVVIGLEDAFLPIKAVHEYVTANEKVKYVCGYLENKKLSA AELSEIAVLPSRDELYSMFLSVLQAPVGKFMYALKAVADTKQQ |
© Fisunov Lab of Proteomics, 2016.