GCW_00830
![]() ![]() ![]() |
Uniprot: A0A0F6CK41
Description: 50S ribosomal protein L7/L12 EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: Forms part of the ribosomal stalk which helps the ribosome interact with GTP-bound translation factors. Is thus essential for accurate translation. {ECO:0000256|HAMAP-Rule:MF_00368}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): rplL Gene names (synonym): Mass: 12,574 Subunit structure [CC]: SUBUNIT: Homodimer. Part of the ribosomal stalk of the 50S ribosomal subunit. Forms a multimeric L10(L12)X complex, where L10 forms an elongated spine to which 2 to 4 L12 dimers bind in a sequential fashion. Binds GTP-bound translation factors. {ECO:0000256|HAMAP-Rule:MF_00368}. Gene ontology (GO): ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412] Gene ontology IDs: GO:0003735; GO:0005840; GO:0006412 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ribosomal protein L7/L12P family. {ECO:0000256|HAMAP-Rule:MF_00368}. Protein families: Ribosomal protein L7/L12P family Coiled coil: Domain [FT]: DOMAIN 5 51 Ribosomal_L12_N. {ECO:0000259|Pfam:PF16320}.; DOMAIN 56 121 Ribosomal_L12. {ECO:0000259|Pfam:PF00542}. Motif: Region: EMBL: CP006916 ProteinModelPortal: MEROPS: EnsemblBacteria KO: AHB99463 UniPathway: K02935 CDD: Gene3D: cd00387 HAMAP: 3.30.1390.10 InterPro: MF_00368 PANTHER: IPR000206;IPR014719;IPR013823;IPR008932 PIRSF: PRINTS: PROSITE: Pfam: ProDom: PF00542;PF16320 SMART: PD001326 SUPFAM: TIGRFAMs: SSF48300;SSF54736 In one protein complex with GCW_00825 186674-187040(+) >nucleotide sequence ATCAACGATGTAATTAAAGCAATCGAAGAAGCATTCGGTGTTTCAGCTGCTGCTCCTGTA GCTGCTGCTGCAGCTGCTCCAGCGGCTGCTGCTCCAACTGAAGCAACAGTTGTTTTAGTA TCAGCTGGTGATAAGAAAGTTGAAGTTATTAAACTAGTAAGAGAAGTAACTGGTTTAGGT TTAATGGATGCTAAGAAAGCAGTTGACACTCCTCCTGCAACTATTAAAGAAAATATGAAT ATTGAAGAAGCTAAAGCATTAAAAGCTAAGTTCGAAGCTGTTGGTGCTAAAGTTGATCTT AAATAA >protein sequence SAGDKKVEVIKLVREVTGLGLMDAKKAVDTPPATIKENMNIEEAKALKAKFEAVGAKVDL K |
© Fisunov Lab of Proteomics, 2016.