GCW_00905







Uniprot: A0A0F6CK54
Description: glutamine amidotransferase
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 20,526
Subunit structure [CC]: 
Gene ontology (GO): transferase activity [GO:0016740]; glutamine metabolic process [GO:0006541]
Gene ontology IDs: GO:0006541; GO:0016740
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 1 115 DJ-1_PfpI. {ECO:0000259|Pfam:PF01965}.
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: A0A0F6CK54
MEROPS: 
EnsemblBacteria KO: AHB99476
UniPathway: K03152
CDD: 
Gene3D: 
HAMAP: 3.40.50.880
InterPro: 
PANTHER: IPR029062;IPR002818
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: 
ProDom: PF01965
SMART: 
SUPFAM: 
TIGRFAMs: SSF52317
202608-203160(+)

>nucleotide sequence
TTGAAATTACTTGTATTAACTATTAAAGAATTCCAAGATATTGAATTAGTAAGCTTTGCT
TCAATCTTAACTGCAAGTGGTAAGTTTAGTAAAATAGATTATTATTCACCAGAAGAAAAA
GATAGTGTTGTGGGACAATTTAATGTAGCACACATTAAAACGATCAAATCATTTAATGTT
AATGATTATGATGCGATCTACGTTCCAGGTGGGATGGGAGCAATCCACTTAAGAACTAAC
CAAAAAGGTCTTGCGGCTGTTCATGAATTTGTTAAAGCTAATAAGTGAGTGATTGCGATC
TGTGACTCACCAAACGCGTTAAGTGAAAACAAGATTTTAAGCCCAGAAGATAAGTACATT
TCTTGAAGCGATGGGACAATGAATCATCCTAACCGAATCAAGGATTTCAACGTTCAATTA
AATCGTTCTAATAAATTAATTACGGGAAGATGTTCACTAACTACTTTAGAATTAGCATTC
TATACATTAGAAGTATTGTTCTCTAAAGAATTTAGTGAAGAGTTAAGAGCAAAACTAACA
GGTGTTGCTTAA


>protein sequence
LKLLVLTIKEFQDIELVSFASILTASGKFSKIDYYSPEEKDSVVGQFNVAHIKTIKSFNV
NDYDAIYVPGGMGAIHLRTNQKGLAAVHEFVKANKWVIAICDSPNALSENKILSPEDKYI
SWSDGTMNHPNRIKDFNVQLNRSNKLITGRCSLTTLELAFYTLEVLFSKEFSEELRAKLT
GVA






















© Fisunov Lab of Proteomics, 2016.