GCW_01105
![]() ![]() ![]() |
Uniprot: A0A0F6CK81
Description: transcription elongation factor GreA EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: Necessary for efficient RNA polymerase transcription elongation past template-encoded arresting sites. The arresting sites in DNA have the property of trapping a certain fraction of elongating RNA polymerases that pass through, resulting in locked ternary complexes. Cleavage of the nascent transcript by cleavage factors such as GreA or GreB allows the resumption of elongation from the new 3'terminus. GreA releases sequences of 2 to 3 nucleotides. {ECO:0000256|HAMAP-Rule:MF_00105, ECO:0000256|RuleBase:RU000556, ECO:0000256|SAAS:SAAS00338401}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): greA Gene names (synonym): Mass: 17,944 Subunit structure [CC]: Gene ontology (GO): DNA binding [GO:0003677]; translation elongation factor activity [GO:0003746]; regulation of DNA-templated transcription, elongation [GO:0032784]; transcription, DNA-templated [GO:0006351] Gene ontology IDs: GO:0003677; GO:0003746; GO:0006351; GO:0032784 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the GreA/GreB family. {ECO:0000256|HAMAP-Rule:MF_00105, ECO:0000256|RuleBase:RU000556, ECO:0000256|SAAS:SAAS00541981}. Protein families: GreA/GreB family Coiled coil: Domain [FT]: DOMAIN 8 77 GreA_GreB_N. {ECO:0000259|Pfam:PF03449}.; DOMAIN 85 157 GreA_GreB. {ECO:0000259|Pfam:PF01272}. Motif: Region: EMBL: CP006916 ProteinModelPortal: A0A0F6CK81 MEROPS: EnsemblBacteria KO: AHB99503 UniPathway: K03624 CDD: Gene3D: HAMAP: 1.10.287.180;3.10.50.30 InterPro: MF_00105 PANTHER: IPR018151;IPR006359;IPR028624;IPR001437;IPR023459;IPR022691 PIRSF: PRINTS: PIRSF006092 PROSITE: Pfam: PS00829 ProDom: PF01272;PF03449 SMART: SUPFAM: TIGRFAMs: SSF46557 250561-251041(+) >nucleotide sequence CTAAGACTTTTAGTTGATGTTAAACGTGCAGATGTAATTAAATTAATTCAAGAAGCACGT GAGCAAGGTGACTTATCTGAAAATGCTGATTATGATTCAGCTAAAGCAACTCAAAGCGAG ATCGAAAGTCGGATTACTGAGATTCAAGATATCTTAAATCACTATGAGATCATCAAAGAA GTTGATACGAAAAACAAACGGGTAATCGTTGGTGCTAAAGTAACGATCCACGATCATTCA GATGAATGTAATTATACGTATGAGATTGTGGGTCCAATTGAAAGTGATCCAGCTGAAAAT AAGATCTCACACGAATCACCTGTAGCTAAAGCGATCATGGATAAAAAAGAAGGTGAATCA GCTGAAGTGATCGGGATTGAACACCCTTATAAAGTAACGATTAAAAAGATCGTGCTTTAG >protein sequence IESRITEIQDILNHYEIIKEVDTKNKRVIVGAKVTIHDHSDECNYTYEIVGPIESDPAEN KISHESPVAKAIMDKKEGESAEVIGIEHPYKVTIKKIVL |
© Fisunov Lab of Proteomics, 2016.