GCW_01605







Uniprot: A0A0F6CKF1
Description: Fe-S cluster assembly protein SufB
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): sufB
Gene names (synonym): 
Mass: 52,596
Subunit structure [CC]: 
Gene ontology (GO): iron-sulfur cluster assembly [GO:0016226]
Gene ontology IDs: GO:0016226
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: 
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: AHB99573
UniPathway: K09014
CDD: 
Gene3D: 
HAMAP: 
InterPro: 
PANTHER: IPR010231;IPR000825
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: 
ProDom: PF01458
SMART: 
SUPFAM: 
TIGRFAMs: 

In one protein complex with GCW_01585 375937-377338(+)

>nucleotide sequence
ATGCCGATATCAAAAAAAATCTTAAACAAAAAATACCAGTATGGTTTTTATGATAAAGAT
ACTTCAATTTTTGAAACTACTAAAGGAATCTCTAGAGAGATTGTTAAGAAGATTTCTAAA
CTAAAAAACGAACCAGAATGGATGTTAAAGATCAGATTAGAAGCATTTGATACCTTTATG
AAGATGCCAAATCCTAGCTGGGGTCCTGATTTATCATTTATTGATTATGATAATGCAGTA
ATGTATTCTAAAGCAGTTAATAATCCTCAATACAGTTGGGATCAAGTGCCTAAGAAGATT
AAAAACACATTTAAAAAACTAGGAATTCTAGAAGCAGAAGCTAAATTTTTAAACGGGGTT
TCAACTCAGTATGATTCCCAAGCTGTTTATCATAGTATTGAAAAAGAGTTAGCTGAAAAT
GGTGTGATTTTTACTGATACTGACACAGCAGTACAGAAATATCCAGAATTAGTAAAGAAA
TATTTTGGTTCAATTGTGCCAACAAACGACAATAAGTTTGCTGCACTAAACACGGCATTC
TGATCGGGCGGGTCATTTGTTTATGTGCCTAAAGGTGTTGAGATTAAAAAACCCTTACAA
GCTTACTTCAGAATCAATGGTCGTAGGGTAGGTCAATTCGAACGGACAATTATTATCCTT
GAAGAAGGTGCAAAATGTCACTACGTTGAAGGTTGTACAGCTCCGGTTTATTCAGAAGAC
AACTTACATTGTGCTGTGGTTGAAGTTTTCTTGCATAAAAACTCAGTGGGAAGATATACG
ACAATCCAAAACTGATCTGATAACGTTTTAAATTTAGTTACTAAACGCTCAATCGTTTAT
GAAAATGCCAAAATGTCATGAATTGATGGGAATATTGGCGCAAGAATTAATATGAAGTAT
CCTTCATCAATTCTAACTGGAGAATATGCTTCAAGTGACTGTATCTCAATTGCTGTAGCT
AATAAAGGGATTATTCAAGATGCGGGTGCTAAGATGATCCATTTAGCACCTCATACTAAA
TCTAGAATCGTTTCAAAATCAGTTTCATTTAACGGCGGGGACACTTGTTATCGTGGTTTA
GTTAAAATCGGAAAAGATGCCCACTATTCAAGTTCAAAAGTTGAGTGTGACACCTTATTG
ATCGATAATATCTCAAGAACTGATACGTTACCAACTGAGATTATTGAGAATAAATACTCT
TCTCTAGAACATGAAGCAAAAGTTTCAAATATTAGTGAAGAACAACTTTTCTACATGATG
TCTAAAGGGATTCCTAAAGATGTGGCTGAAAACCTGATCGTTCTAGGTTTTATTGAACCT
TTCACTAAAGAATTGCCAATGGAATATGCGATCGAATTGAACCGTTTAATTACGATGGAT
ATGGAAGGGAGTGTTGGTTAA


>protein sequence
MPISKKILNKKYQYGFYDKDTSIFETTKGISREIVKKISKLKNEPEWMLKIRLEAFDTFM
KMPNPSWGPDLSFIDYDNAVMYSKAVNNPQYSWDQVPKKIKNTFKKLGILEAEAKFLNGV
STQYDSQAVYHSIEKELAENGVIFTDTDTAVQKYPELVKKYFGSIVPTNDNKFAALNTAF
WSGGSFVYVPKGVEIKKPLQAYFRINGRRVGQFERTIIILEEGAKCHYVEGCTAPVYSED
NLHCAVVEVFLHKNSVGRYTTIQNWSDNVLNLVTKRSIVYENAKMSWIDGNIGARINMKY
PSSILTGEYASSDCISIAVANKGIIQDAGAKMIHLAPHTKSRIVSKSVSFNGGDTCYRGL
VKIGKDAHYSSSKVECDTLLIDNISRTDTLPTEIIENKYSSLEHEAKVSNISEEQLFYMM
SKGIPKDVAENLIVLGFIEPFTKELPMEYAIELNRLITMDMEGSVG






















© Fisunov Lab of Proteomics, 2016.