GCW_01730
![]() ![]() ![]() |
Uniprot: A0A0F6CKH2
Description: F0F1 ATP synthase subunit delta EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: F(1)F(0) ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F(1) containing the extramembraneous catalytic core and F(0) containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F(1) is coupled via a rotary mechanism of the central stalk subunits to proton translocation. {ECO:0000256|HAMAP-Rule:MF_01416}.; FUNCTION: This protein is part of the stalk that links CF(0) to CF(1). It either transmits conformational changes from CF(0) to CF(1) or is implicated in proton conduction. {ECO:0000256|HAMAP-Rule:MF_01416}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): atpH Gene names (synonym): Mass: 21,175 Subunit structure [CC]: Gene ontology (GO): plasma membrane [GO:0005886]; proton-transporting ATP synthase complex, catalytic core F(1) [GO:0045261]; proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]; plasma membrane ATP synthesis coupled proton transport [GO:0042777] Gene ontology IDs: GO:0005886; GO:0042777; GO:0045261; GO:0046933 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ATPase delta chain family. {ECO:0000256|HAMAP-Rule:MF_01416, ECO:0000256|SAAS:SAAS00542976}. Protein families: ATPase delta chain family Coiled coil: Domain [FT]: Motif: Region: EMBL: CP006916 ProteinModelPortal: A0A0F6CKH2 MEROPS: EnsemblBacteria KO: AHB99594 UniPathway: K02113 CDD: Gene3D: HAMAP: 1.10.520.20 InterPro: MF_01416 PANTHER: IPR020781;IPR026015;IPR000711 PIRSF: PTHR11910 PRINTS: PROSITE: PR00125 Pfam: PS00389 ProDom: PF00213 SMART: SUPFAM: TIGRFAMs: SSF47928 In one protein complex with GCW_01750 GCW_03675 GCW_01740 GCW_03680 400727-401273(+) >nucleotide sequence AAGGTACATTTGTTTTATGACAATCTTAAAGTCGTTTTTGACTTGGTTAAGGAAAACCAA GACTTAATGTCATTAATGAATAGTCAAGTCTTATCTAAAAACCAAAAACATGAGATTATT GATGTTGTGTTTAAAGACCACTTAACCCAAACGATCGTTGACTTCTTAAAAGTAGTGATC GATAACCGCGAGTTTTTCCATATTAAATCGATCATTAAAAAGTTCTTTAGAATGATCGAA GAAGAAGAGCACACAATCTTTATTAATGTCGTCTCAGCACATGAACTAAACGACGATCAA AAAGCTCAGTTAGTTGAAAAACTCCATAAGAAGTTTGCTTCACAAGTCAAAATCTTATAT CAAACTGATCCCAGTTTGATTGCTGGAATCAGGATCCAATCAAATGATCTCTTAATTGAT AACTCAATTGATGGCAAACTCAAACTACTAAAACATCAACTTAGAACCTTCTCCAAGGAA AACTAG >protein sequence DVVFKDHLTQTIVDFLKVVIDNREFFHIKSIIKKFFRMIEEEEHTIFINVVSAHELNDDQ KAQLVEKLHKKFASQVKILYQTDPSLIAGIRIQSNDLLIDNSIDGKLKLLKHQLRTFSKE N |
© Fisunov Lab of Proteomics, 2016.