GCW_01745







Uniprot: A0A0F6CKH5
Description: F0F1 ATP synthase subunit beta
EC number: 3.6.3.14
Annotation score: 3 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: CATALYTIC ACTIVITY: ATP + H(2)O + H(+)(In) = ADP + phosphate + H(+)(Out). {ECO:0000256|HAMAP-Rule:MF_01347}.
Cofactor: 
Enzyme regulation: 
Function [CC]: FUNCTION: Produces ATP from ADP in the presence of a proton gradient across the membrane. The catalytic sites are hosted primarily by the beta subunits. {ECO:0000256|HAMAP-Rule:MF_01347}.
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: NP_BIND 156 163 ATP. {ECO:0000256|HAMAP-Rule:MF_01347}.
Site: 
Gene names (primary): atpD_1
Gene names (synonym): atpD
Mass: 51,492
Subunit structure [CC]: 
Gene ontology (GO): plasma membrane [GO:0005886]; proton-transporting ATP synthase complex, catalytic core F(1) [GO:0045261]; ATP binding [GO:0005524]; proton-transporting ATP synthase activity, rotational mechanism [GO:0046933]; ATP hydrolysis coupled proton transport [GO:0015991]; plasma membrane ATP synthesis coupled proton transport [GO:0042777]
Gene ontology IDs: GO:0005524; GO:0005886; GO:0015991; GO:0042777; GO:0045261; GO:0046933
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the ATPase alpha/beta chains family. {ECO:0000256|HAMAP-Rule:MF_01347}.
Protein families: ATPase alpha/beta chains family
Coiled coil: 
Domain [FT]: DOMAIN 148 375 AAA. {ECO:0000259|SMART:SM00382}.
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: AHB99597
UniPathway: K02112
CDD: 
Gene3D: 
HAMAP: 1.10.1140.10;3.40.50.300
InterPro: MF_01347
PANTHER: IPR003593;IPR020003;IPR005722;IPR000793;IPR000194;IPR004100;IPR024034;IPR027417
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: PS00152
ProDom: PF00006;PF02874
SMART: 
SUPFAM: SM00382
TIGRFAMs: SSF47917;SSF50615;SSF52540
403713-405129(+)

>nucleotide sequence
ATGAATACAAAATACAGTTATGGTAAGGTTTACCAAGTAGTTGGTCCAGTTGTGGATGTT
GTTTTTGAAAAACAAGATGACCTACCTAAGATCTATGATTGTTTGATCATCGATGAACCA
AATATGAAACTTCATCTAGAAGTTGCTCAGTTAATTGGTGATGATATTGCAAGATGTATT
GCGATGGGTCCAACTGAAGGGTTGGCTAGAAATGTGAAAGTAACTTCAACTAACCAACCG
ATTTCGGTACCTGTAGGGACTGAAGTATTAGGCCGGATGTTTAATGTGATTGGTGAACCG
ATCGACGAGAAAAAACCGATCGATGCATCAGTAAAAAGAATGTCAATTCACCGTCCTGCT
CCCAGTTTTGCTGACCAATCTAACGAGTTAGAGATCTTTGAAACCGGGATCAAAGTGATC
GATCTTTTAATTCCTTATGCAAAAGGTGGTAAGATCGGTCTATTTGGTGGCGCTGGTGTT
GGTAAAACGGTATTAGTACAAGAATTAATCCATAATATTGCAACTGGTCACGGTGGTTTA
TCTGTCTTTGCTGGTGTTGGTGAAAGAACTCGTGAAGGAAACGATCTTTATTATGAAATG
ATCGAAGGTGGGGTGATTGATAAGACCGCATTAGTTTTTGGTCAGATGAATGAACCTCCC
GGTGCCAGAATGCGTGTGGCGCTTACGGGATTAACGATGGCTGAATATTTCAGAGATGTT
AATAACCAAGATGTCTTATTATTCATTGATAATATCTTCAGATTCACCCAAGCTGGTTCA
GAAGTATCAGCACTATTAGGTCGGATGCCTTCAGCTGTAGGTTATCAACCTACTTTAGCT
GAAGAGATGGGTTCATTACAAGAACGGATTACTTCAACTAAATCTGGTTCCATCACTTCC
GTTCAAGCGATCTATGTGCCTGCAGATGACTTAACTGACCCTGCACCATCAACAACGTTT
ACACACCTTGATGCTAAAACAGTTTTAGACCGCAATATTGCTTCACTAGGGATCTTTCCT
GCAGTTAACCCCCTTGATTCAACATCAAGATTACTTGACCCAAGTGTAGTGGGAATTCAA
CACTACCAAACTGCTCGTAAGGTACAGATGATCTTACAAAAATTCTTAGAATTACAAGAT
ATTATTGCGATCCTTGGAATTGACGAACTATCTGAAGAAGATAAGTTAACTGTTTCAAGA
GCACGTAAGATTAGAAACTTCTTATCACAACCGTTCTTTGTTGCTGAAAAATTCAGCGGT
AATAAAGGTAAATACGTACCGATCAGTGAAACAATCAAAGGGTTCAGTGAGATCGTTGAA
GGAAAACATGACGATCTTCCCGAACAAGCATTCTTCTATGTTGGTTCGATCGATGAAGCA
ATTGAAAGAGCTAAAACATTAACATGTAATGGTTAA


>protein sequence
MNTKYSYGKVYQVVGPVVDVVFEKQDDLPKIYDCLIIDEPNMKLHLEVAQLIGDDIARCI
AMGPTEGLARNVKVTSTNQPISVPVGTEVLGRMFNVIGEPIDEKKPIDASVKRMSIHRPA
PSFADQSNELEIFETGIKVIDLLIPYAKGGKIGLFGGAGVGKTVLVQELIHNIATGHGGL
SVFAGVGERTREGNDLYYEMIEGGVIDKTALVFGQMNEPPGARMRVALTGLTMAEYFRDV
NNQDVLLFIDNIFRFTQAGSEVSALLGRMPSAVGYQPTLAEEMGSLQERITSTKSGSITS
VQAIYVPADDLTDPAPSTTFTHLDAKTVLDRNIASLGIFPAVNPLDSTSRLLDPSVVGIQ
HYQTARKVQMILQKFLELQDIIAILGIDELSEEDKLTVSRARKIRNFLSQPFFVAEKFSG
NKGKYVPISETIKGFSEIVEGKHDDLPEQAFFYVGSIDEAIERAKTLTCNG






















© Fisunov Lab of Proteomics, 2016.