GCW_02010







Uniprot: A0A0F6CKL6
Description: excinuclease ABC subunit C
EC number: 
Annotation score: 2 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: FUNCTION: The UvrABC repair system catalyzes the recognition and processing of DNA lesions. UvrC both incises the 5' and 3' sides of the lesion. The N-terminal half is responsible for the 3' incision and the C-terminal half is responsible for the 5' incision. {ECO:0000256|HAMAP-Rule:MF_00203, ECO:0000256|SAAS:SAAS00511299}.
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): uvrC
Gene names (synonym): 
Mass: 69,153
Subunit structure [CC]: SUBUNIT: Interacts with UvrB in an incision complex. {ECO:0000256|HAMAP-Rule:MF_00203, ECO:0000256|SAAS:SAAS00511290}.
Gene ontology (GO): cytoplasm [GO:0005737]; excinuclease repair complex [GO:0009380]; DNA binding [GO:0003677]; excinuclease ABC activity [GO:0009381]; nucleotide-excision repair [GO:0006289]; SOS response [GO:0009432]
Gene ontology IDs: GO:0003677; GO:0005737; GO:0006289; GO:0009380; GO:0009381; GO:0009432
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the UvrC family. {ECO:0000256|HAMAP-Rule:MF_00203, ECO:0000256|SAAS:SAAS00571147}.; SIMILARITY: Contains 1 GIY-YIG domain. {ECO:0000256|HAMAP-Rule:MF_00203}.; SIMILARITY: Contains 1 UVR domain. {ECO:0000256|HAMAP-Rule:MF_00203}.
Protein families: UvrC family
Coiled coil: 
Domain [FT]: DOMAIN 14 91 GIY-YIG. {ECO:0000259|PROSITE:PS50164}.; DOMAIN 249 468 UVRC. {ECO:0000259|PROSITE:PS50165}.
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: AHB99638
UniPathway: K03703
CDD: 
Gene3D: 
HAMAP: 3.40.1440.10
InterPro: MF_00203
PANTHER: IPR027299;IPR000305;IPR010994;IPR004791;IPR001162
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: PS50164;PS50165
ProDom: PF01541;PF08459
SMART: 
SUPFAM: SM00465
TIGRFAMs: SSF47781;SSF82771

In one protein complex with GCW_00205 GCW_00470 475991-477770(+)

>nucleotide sequence
ATGAATTTTAATCTCAAACAAAAACTAGATCTGGCCCCAAAAAAACCAGGGTGTTACCTA
TGAAAGAATCACCTTAATGAGATTATTTACATAGGTAAAGCTAAAAATATCTACAAGAGG
GTGCACCAATACTTTAATGGGCCAAAAGATCTGAAAACATCAAAGCTCGTTAATGAGATC
TTTTATGTTGAATTCATTGAAGTTAATAATGAAAATGAAGCTTTATTATTAGAAGCTAAT
CTAATAAAAAAGCATAAACCTAGATATAATATCTTATTAAAGGATAACAATGGTTATCCT
TATATCTTGATTACGAAAGAAAAGTATCCAAGACTAATTTATACGCGTAACTTTGATCCC
AAAAAAGGTAAACATTACGGCCCTTTTGCTTCAAGTGAGATGAAAGCATATGATCTTTAT
AACCTTTTATTAAAACTGTTTCCACTAAAAAACTGTTTTAATAAAAAGGGCCGTAAGTGT
GAGTTTTATGATCTTAATTTATGTATGAAAGCATGCACTCACGAAGTTAGTGAAGCTGAT
TATGAAGTGATGAAAAAAAAGATCGATTATTTTTTTCATAACGGTGCTGATCAAGTTTTA
AAAGGCTTAAAAGAAAAAGAGTTGATCGCTAGTGAAAAATTTGATTTTGAACAAGCCAAA
AAATATTTAGATCTGCAAAAAGCGATCAATCTAATCTTTGATAAACAGATTATTAATCTG
TATAGTGCAAAAGAACGAATCGATGTTCTAGCTTATCAGATCAAAGAAAATGTGATCTGT
ATCGTTTTATTTTCTTATGTTTCAAGTCAACTTGTATCTAAAAACACGATCTGTGATTTT
TACTATGGTGAAGAACAAGAAGTAATTACTTCTTATCTTAGTCAATACTATAAAGATAAT
ATCAAACCCAAGATCTTATATGCTTCTTTAGATCAAGCAAATGCAACCTTATTAAAGGAC
AGTCTTGGAATTGAGATTATCAATCCCACAAGTGGGAAGATGAATGAGATTATGTCATTA
GCACTTCAAAATGTAACTAATGAACTATCCCAAAAATATGATTCCTTAGTTAAAAAAGAA
CAAAGAATCAATCTAGCCCTAGATCAATTAAAAGAATTGATCAAGGTTGATAAACTCAAT
AATCTAGAAGTGTATGATAATTCCAACTTGTTTAATACGGATAAAGTATCAGCAATGATT
GTTTTTGAAAACAATCAGTTTAATAAGAAGAAATACCGTAAATATAAGATTAAAGATCAA
CAATCACTAGGTGATTATCATTATATGTATGAAGTGATCTATCGCAGGTTGTATCAAGCT
TTAAAAAACAATTTTGTTGATCTACCTGATCTGATTATTCTAGATGGTGGTAAACACCAA
GTGTTAGCAGCAAAAAAAGCGATTGTCGATCTTCAGATCGATCAAAAGATCAATCTGATT
GGTTTAGCTAAGAACAATAAACACCAAACAGATAAGATCCTCACTTCTGATCTTGATGAG
ATCAGTTTAGATAAGAGTTCGGCGTTATATTTTTTCTTAGCCAATCTTCAAGAAGAAGTG
CACAAGTTTGCGATTAGTTTTTTTCGTAAAACTAAAGCCAAATCATTATATGATTCTATT
CTTGATCAGATCAAGGGGTTGGGTAAGAAAAGAAAGCAACAATTGATCGAACATTTTAAA
ACGATTGATGAGATTAAAAAAGCTTCGATTGCTAGTTTAAGTCAAGTCTTACCAATGGAG
ATTGCTAAAAAGTTGAAGCAGAAATTAGATCAATCGTAG


>protein sequence
MNFNLKQKLDLAPKKPGCYLWKNHLNEIIYIGKAKNIYKRVHQYFNGPKDLKTSKLVNEI
FYVEFIEVNNENEALLLEANLIKKHKPRYNILLKDNNGYPYILITKEKYPRLIYTRNFDP
KKGKHYGPFASSEMKAYDLYNLLLKLFPLKNCFNKKGRKCEFYDLNLCMKACTHEVSEAD
YEVMKKKIDYFFHNGADQVLKGLKEKELIASEKFDFEQAKKYLDLQKAINLIFDKQIINL
YSAKERIDVLAYQIKENVICIVLFSYVSSQLVSKNTICDFYYGEEQEVITSYLSQYYKDN
IKPKILYASLDQANATLLKDSLGIEIINPTSGKMNEIMSLALQNVTNELSQKYDSLVKKE
QRINLALDQLKELIKVDKLNNLEVYDNSNLFNTDKVSAMIVFENNQFNKKKYRKYKIKDQ
QSLGDYHYMYEVIYRRLYQALKNNFVDLPDLIILDGGKHQVLAAKKAIVDLQIDQKINLI
GLAKNNKHQTDKILTSDLDEISLDKSSALYFFLANLQEEVHKFAISFFRKTKAKSLYDSI
LDQIKGLGKKRKQQLIEHFKTIDEIKKASIASLSQVLPMEIAKKLKQKLDQS






















© Fisunov Lab of Proteomics, 2016.