GCW_02070







Uniprot: A0A0F6CKM4
Description: 50S ribosomal protein L21
EC number: 
Annotation score: 2 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: FUNCTION: This protein binds to 23S rRNA in the presence of protein L20. {ECO:0000256|RuleBase:RU000562, ECO:0000256|SAAS:SAAS00030247}.
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): rplU
Gene names (synonym): 
Mass: 11,444
Subunit structure [CC]: SUBUNIT: Part of the 50S ribosomal subunit. Contacts protein L20. {ECO:0000256|SAAS:SAAS00030271}.
Gene ontology (GO): ribosome [GO:0005840]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412]
Gene ontology IDs: GO:0003735; GO:0005840; GO:0006412; GO:0019843
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the ribosomal protein L21P family. {ECO:0000256|HAMAP-Rule:MF_01363, ECO:0000256|RuleBase:RU000562, ECO:0000256|SAAS:SAAS00546832}.
Protein families: Ribosomal protein L21P family
Coiled coil: 
Domain [FT]: 
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: AHB99646
UniPathway: K02888
CDD: 
Gene3D: 
HAMAP: 
InterPro: MF_01363
PANTHER: IPR028909;IPR001787;IPR018258
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: PS01169
ProDom: PF00829
SMART: 
SUPFAM: 
TIGRFAMs: SSF141091
489864-490167(+)

>nucleotide sequence
ATGTTTGCAGTTATTGCATCAGGCTCAAAACAGTACCGCGTTAAGTTAAACGATGAAATC
TACGTGGAAAAACTAAATTCTCAAGTAGGTGAAAAAATCGTTTTTGACAAAGTGTATTTT
GTGAACAACACTTTTGGTAAACCTTTTGTTAAGGGCGCTTCTGTTACTTGTGAAGTGCTT
AAACAAGGTAAGCAAAAGAAGATTAATGTGATTAAACACATTTCACAAAAACACCACTTA
AAAAAATACGGTCACAGACAACCATACACCAAGCTTAAAGTTGTAGCGATCAACCACGGA
TAA


>protein sequence
MFAVIASGSKQYRVKLNDEIYVEKLNSQVGEKIVFDKVYFVNNTFGKPFVKGASVTCEVL
KQGKQKKINVIKHISQKHHLKKYGHRQPYTKLKVVAINHG






















© Fisunov Lab of Proteomics, 2016.