GCW_02590







Uniprot: A0A0F6CKU8
Description: peptidase M17
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): pepA
Gene names (synonym): 
Mass: 49,240
Subunit structure [CC]: 
Gene ontology (GO): cytoplasm [GO:0005737]; aminopeptidase activity [GO:0004177]; manganese ion binding [GO:0030145]; metalloexopeptidase activity [GO:0008235]
Gene ontology IDs: GO:0004177; GO:0005737; GO:0008235; GO:0030145
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the peptidase M17 family. {ECO:0000256|SAAS:SAAS00610377}.
Protein families: Peptidase M17 family
Coiled coil: 
Domain [FT]: DOMAIN 298 305 CYTOSOL_AP. {ECO:0000259|PROSITE:PS00631}.
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: A0A0F6CKU8
MEROPS: 
EnsemblBacteria KO: AHB99720
UniPathway: K01255
CDD: 
Gene3D: cd00433
HAMAP: 
InterPro: 
PANTHER: IPR011356;IPR000819
PIRSF: PTHR11963
PRINTS: 
PROSITE: PR00481
Pfam: PS00631
ProDom: PF00883
SMART: 
SUPFAM: 
TIGRFAMs: 
613754-615092(-)

>nucleotide sequence
TTACTTTTGGTTTTTTGCTTGTAAGTATAAAGCACGAATCATTGGTGATAAACCAAGCCC
AGCTTTATCTGATCCAGTACCAGCAATATCACAGTGGATTAGATCAACACCTTCAGCAAA
TTCATTTAAGAACATTGCCGCTCTTGATGAACCAGCATAAGGCGCATTAGTTGAGTTAGC
AATATCAGCTAAAGGAGTTTTTAGCATTTCTAAATAATCGTTGTGCATTGGTAATCTTCA
AACCGCTTCACCAGCTGAGAACGCATTGTCTTCAAATTCTTTTCAGAACTTATCAGATGT
TGAAAAAACACCAGTGTAAGTTTTACCTAGGATGTAGCTCATTAATCCAGTTAATGTTGC
TACATCAAAAATTCTAGTTGCTTTAACATCAAGTGCTGCATATGAGATTGCATCAGCCAA
CACTAAACGACCTTCTGCATCAGTGTTATCAATTTCAACAGTTTTCTTATTGTAAGCGAC
TACGATATCATCAGGACGTTGTGCTTTTGGACCAATTAAATTTTCAGTTAAAGGCGCAAG
TGCTACAACATTGGTTTTAACTTTGTTTTTAGCTAACGCTAAAACTGTTGATACAACGAT
CGCTGCACCTGACATATCATATTTCATATTTCTCATGTGAGGACCAGTTTTTAAGTTCAT
CCCCCCTGAGTCATAAGTAATTCCCTTACCAACGTAAGCAAATTTTTCTTTTGATGATTT
GTTGTTTAAGTATTCAACAACTAAGAAACGGCATTCTCTTTCTGAACCTTTATTTACTCC
GTACAAAAGGTTTAGTCCCATCTTTTTGATCTGTTCTTTGTTGTATACTGATAGTTTAAC
GTTCTTAAGGTCTTTGAATTCAGCTTTGAATAGATCAACAAAAGTTTCTGGGTATAACAC
ATCAGAAGGAGTATCTTGTAATCTTCTTGATAATGTAACAGCTTCAGCCACGTTTTTAGC
AGCATCATAAGCAGCTTTAAATTCTTTAGAAACTTTAACAAGGAAACTTGGTTTAGTATC
TGGTTTAGTTTTTCTTGTAAACGGAATGACACTAGCATATTCAATTGCACAAGCAACTAG
CAATGCTACAGTTTCACTATCAGCATTAGTTGCTGTTAAAAAGCTATCAAGATCTACTTC
AACTTTTTCTTTTTGTGAGCAGAACATCTCAACTAGTTTGTTGTACAACTTAACACCATC
ATAATGTGAAGTAAATTCAAACAGCACAACCCCGCCTTCAGTTTTAAAAGTGTAATCTTT
TAATTTGTTATTAACCTTGGCTTGAACTAATAACATCTTCTTTGAAGAAGAATGAGTTTT
TTTCGTATTTTTTTCCAT


>protein sequence
MEKNTKKTHSSSKKMLLVQAKVNNKLKDYTFKTEGGVVLFEFTSHYDGVKLYNKLVEMFC
SQKEKVEVDLDSFLTATNADSETVALLVACAIEYASVIPFTRKTKPDTKPSFLVKVSKEF
KAAYDAAKNVAEAVTLSRRLQDTPSDVLYPETFVDLFKAEFKDLKNVKLSVYNKEQIKKM
GLNLLYGVNKGSERECRFLVVEYLNNKSSKEKFAYVGKGITYDSGGMNLKTGPHMRNMKY
DMSGAAIVVSTVLALAKNKVKTNVVALAPLTENLIGPKAQRPDDIVVAYNKKTVEIDNTD
AEGRLVLADAISYAALDVKATRIFDVATLTGLMSYILGKTYTGVFSTSDKFWKEFEDNAF
SAGEAVWRLPMHNDYLEMLKTPLADIANSTNAPYAGSSRAAMFLNEFAEGVDLIHCDIAG
TGSDKAGLGLSPMIRALYLQAKNQK






















© Fisunov Lab of Proteomics, 2016.