GCW_02755







Uniprot: A0A0F6CKX8
Description: NADH oxidase
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 51,567
Subunit structure [CC]: 
Gene ontology (GO): cell [GO:0005623]; flavin adenine dinucleotide binding [GO:0050660]; oxidoreductase activity [GO:0016491]; cell redox homeostasis [GO:0045454]
Gene ontology IDs: GO:0005623; GO:0016491; GO:0045454; GO:0050660
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 2 322 FAD/NAD-binding_dom. {ECO:0000259|Pfam:PF07992}.; DOMAIN 351 447 Pyr_redox_dim. {ECO:0000259|Pfam:PF02852}.
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: AHB99750
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 3.30.390.30;3.50.50.60
InterPro: 
PANTHER: IPR023753;IPR016156;IPR004099
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: 
ProDom: PF07992;PF02852
SMART: 
SUPFAM: 
TIGRFAMs: SSF51905;SSF55424

In one protein complex with GCW_02735 GCW_02740 GCW_02745 GCW_02750 GCW_02760 GCW_02720 652539-653958(-)

>nucleotide sequence
CTATTTTTTAATGCTTTCTTTGAAGTAATTTAATCCTAAAGCTTGTAGAATTGCACTAAT
GATAAAGTTAAATGGTTTGTTGTAGTGAGGTAAAAAGAATACATCAGCGAATGCAAGATC
AACTAATGTTAATTTTCTTTGAATTGCTAATGCTAATAAGTAAATAACTTCAGAGTGGTT
ATTTTTAGTTGAACCTACTTGAGCACCTAATAGTCTTAGAGTTTTAGGATCATATACTAA
TTTAATCTTCACTCTGTCATAAGTGTTCATTCATTCTGGACGGTCAGCATCTTCAAAGTA
TGAAGCAACAGCTTCGATTCCACGAATTTTAGCAACTTCTTCTGAGATCCCAGTTGATGC
TAAGTGGTGACCAAATACGTGGATCGCGTTTGTACCAACAACGTTTTCTAACTTAATGTT
AGTCATACCATTAATGTGAGAAGCAGCTACCACACCAGTTTTAACTGCGTTAGTTGCTAA
GTCGATGTTTTGGTATTCACCAGTTGCTGCGTTCATAATTGCAGCAGCACCACCGATTGC
ATATACATCTTTAACAGAAGTTTGGCAGTATTGGTCAATAATTAAAGCACCGTTTTTCAC
TTTGTGAGCGTCAGCTAAAAGTGATGTGTTTGGTAAGAAACCGATACATTGAATTACTAA
GTCAGCTTCTACTTTAGTTTGAACGCCATCTTTTTCTAAAGTAATTCCACGGATCACTTT
TTTGCCACCTTCAGTGTCAACTAAGTATCCCATTACTTTAGTTCCGCACCTAACGTCAAC
TCCTTCTTTTTTCATAGTTGTCATTAGATCTGTACCAAATTCTTTATCAAAGTAGTTAGC
TGCTGGTCTTGGTAACATATCAACTAATAATGTTTTCTTACCTTTTTGGTGAGCAGCTTC
AACTAATTCAACCCCAATGTAACCTGCACCGATTACAACGATATTATTAACATCAGGTTT
TTTGAATTGGTCAATAATTTCTAAAGCGTGTTGGTAAGTTTTACAAGCAACTAAACCTTC
AATTCCACCACAGTATTTTTCAGTGAAAGGAAGACTAGCATCAGCTGTTGTAATTGGTCA
AGCACCAGTAGCTAAGATTAGCTTGTCATAACTTTCTTCAAAAGTTGAGTTCTTTTCTAA
ATTACGAACAACAACAACCTTTCTATTGTGATCCACTGAAAGCACTTCGTGTTTCATGTG
AACTTTTGCACCCATTGATCTAAGTTGTTCTGGGTTAGAGTAGAATAAGTCAGTTGTATC
TTTAACTACACCACTAACAGCTAAAGCAATACCACATCCTAAGAAAGAGATATTGTCATT
GCGGTCAAATGCTACTACATCTAATTTAGGATTTTCCGCTAACATCGTGCGAATCGCAGA
CGTACCAGCGTGGTTAATTCCTACTACAATAACTTTCAT


>protein sequence
MKVIVVGINHAGTSAIRTMLAENPKLDVVAFDRNDNISFLGCGIALAVSGVVKDTTDLFY
SNPEQLRSMGAKVHMKHEVLSVDHNRKVVVVRNLEKNSTFEESYDKLILATGAWPITTAD
ASLPFTEKYCGGIEGLVACKTYQHALEIIDQFKKPDVNNIVVIGAGYIGVELVEAAHQKG
KKTLLVDMLPRPAANYFDKEFGTDLMTTMKKEGVDVRCGTKVMGYLVDTEGGKKVIRGIT
LEKDGVQTKVEADLVIQCIGFLPNTSLLADAHKVKNGALIIDQYCQTSVKDVYAIGGAAA
IMNAATGEYQNIDLATNAVKTGVVAASHINGMTNIKLENVVGTNAIHVFGHHLASTGISE
EVAKIRGIEAVASYFEDADRPEWMNTYDRVKIKLVYDPKTLRLLGAQVGSTKNNHSEVIY
LLALAIQRKLTLVDLAFADVFFLPHYNKPFNFIISAILQALGLNYFKESIKK






















© Fisunov Lab of Proteomics, 2016.