GCW_03030
![]() ![]() ![]() |
Uniprot: A0A0F6CL24
Description: 30S ribosomal protein S7 EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: One of the primary rRNA binding proteins, it binds directly to 16S rRNA where it nucleates assembly of the head domain of the 30S subunit. Is located at the subunit interface close to the decoding center, probably blocks exit of the E-site tRNA. {ECO:0000256|HAMAP-Rule:MF_00480}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): rpsG Gene names (synonym): Mass: 17,681 Subunit structure [CC]: SUBUNIT: Part of the 30S ribosomal subunit. Contacts proteins S9 and S11. {ECO:0000256|HAMAP-Rule:MF_00480}. Gene ontology (GO): small ribosomal subunit [GO:0015935]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; tRNA binding [GO:0000049]; translation [GO:0006412] Gene ontology IDs: GO:0000049; GO:0003735; GO:0006412; GO:0015935; GO:0019843 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ribosomal protein S7P family. {ECO:0000256|HAMAP-Rule:MF_00480, ECO:0000256|RuleBase:RU003619}. Protein families: Ribosomal protein S7P family Coiled coil: Domain [FT]: DOMAIN 2 148 Ribosomal_S7. {ECO:0000259|Pfam:PF00177}. Motif: Region: EMBL: CP006916 ProteinModelPortal: MEROPS: EnsemblBacteria KO: AHB99796 UniPathway: K02992 CDD: Gene3D: HAMAP: 1.10.455.10 InterPro: MF_00480_B PANTHER: IPR000235;IPR005717;IPR020606;IPR023798 PIRSF: PTHR11205 PRINTS: PIRSF002122 PROSITE: Pfam: PS00052 ProDom: PF00177 SMART: SUPFAM: TIGRFAMs: SSF47973 722282-722750(-) >nucleotide sequence TTTTTTCACTGAAGCTCCAGTGTTATTTGAAGCATCAATAATTTCGTTAGCAATCTTATC TAACATTGTTTTTTCATGACGTTTTCTTGAAAGTGTTACTAATCATCTAAGCGCTAAAGT AACTTTTCTTTCAGGACTTACATCAGTAGGCACTTGGTAGTTAGCACCCGCAATTCGACG AACTTTAAGTTCAAGTCTTGGCATAATGTTTTCCACTGCTTTGTTGAAGATTTCTAACGG ATTTTTTTGGGTTTTTTGAGCAATTAGATCAAATGAACCGTATAAAATCTTCTGAGCAAT CCCTTTTTTACCATCTAACATGATCGCATTGATTGCTCTAGTAACCAGTACTGAGTTATA AACTGGGTCTGGTAATACTTTTCTTTTTTCTGCTCGATTCTTACGCAT >protein sequence FNKAVENIMPRLELKVRRIAGANYQVPTDVSPERKVTLALRWLVTLSRKRHEKTMLDKIA NEIIDASNNTGASVKKREDTHKMAEANKAFAHMRM |
© Fisunov Lab of Proteomics, 2016.