GCW_03035
![]() ![]() ![]() |
Uniprot: A0A0F6CL25
Description: 30S ribosomal protein S12 EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: Interacts with and stabilizes bases of the 16S rRNA that are involved in tRNA selection in the A site and with the mRNA backbone. Located at the interface of the 30S and 50S subunits, it traverses the body of the 30S subunit contacting proteins on the other side and probably holding the rRNA structure together. The combined cluster of proteins S8, S12 and S17 appears to hold together the shoulder and platform of the 30S subunit. {ECO:0000256|HAMAP-Rule:MF_00403, ECO:0000256|RuleBase:RU003623}.; FUNCTION: With S4 and S5 plays an important role in translational accuracy. {ECO:0000256|HAMAP-Rule:MF_00403, ECO:0000256|RuleBase:RU003623}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): rpsL Gene names (synonym): Mass: 15,781 Subunit structure [CC]: SUBUNIT: Part of the 30S ribosomal subunit. Contacts proteins S8 and S17. May interact with IF1 in the 30S initiation complex. {ECO:0000256|HAMAP-Rule:MF_00403, ECO:0000256|RuleBase:RU003623}. Gene ontology (GO): small ribosomal subunit [GO:0015935]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; tRNA binding [GO:0000049]; translation [GO:0006412] Gene ontology IDs: GO:0000049; GO:0003735; GO:0006412; GO:0015935; GO:0019843 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ribosomal protein S12P family. {ECO:0000256|HAMAP-Rule:MF_00403, ECO:0000256|RuleBase:RU003622}. Protein families: Ribosomal protein S12P family Coiled coil: Domain [FT]: Motif: Region: EMBL: CP006916 ProteinModelPortal: A0A0F6CL25 MEROPS: EnsemblBacteria KO: AHB99797 UniPathway: K02950 CDD: Gene3D: cd03368 HAMAP: 2.40.50.140 InterPro: MF_00403_B PANTHER: IPR012340;IPR006032;IPR005679 PIRSF: PTHR11652 PRINTS: PIRSF002133 PROSITE: PR01034 Pfam: PS00055 ProDom: PF00164 SMART: SUPFAM: TIGRFAMs: SSF50249 722759-723185(-) >nucleotide sequence TTTATCTACACCAGTTGTATCTAAAGTACCACGAACGATATGATATCTTACCCCTGGTAA GTCCTTAACACGGCCGCCTCTGATTAAAACAACTGAGTGTTCTTGTAAGTTATGACCTTC ACCTGGGATATAAGCTAATACTTCCATACCATTAGTTAGTTTTACCTTAGCGTACTTACG TAACGCTGAGTTAGGTTTTTTGGGTGTCATCGTTCCCACACGGGTACATACACCACGTTT GAATGGTGATGATTTACTAGTCACCTTCTTTTCAAGAGTGTTTAAATTAACTTGCAAAGC AGGAGATTTGGATTTTTTAACCTTGTGTCTTCTTGGTTTTCTAATTAATTGTGCAATTGT TGCCAT >protein sequence ALRKYAKVKLTNGMEVLAYIPGEGHNLQEHSVVLIRGGRVKDLPGVRYHIVRGTLDTTGV DKRRQQRSAYGAKRPKADKKK |
© Fisunov Lab of Proteomics, 2016.