GCW_03125







Uniprot: A0A0F6CL38
Description: haloacid dehalogenase
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 32,971
Subunit structure [CC]: 
Gene ontology (GO): hydrolase activity [GO:0016787]
Gene ontology IDs: GO:0016787
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: 
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 15 268 HAD-like_dom. {ECO:0000259|Pfam:PF08282}.
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: AHB99810
UniPathway: K07024
CDD: 
Gene3D: 
HAMAP: 3.40.50.1000
InterPro: 
PANTHER: IPR023214;IPR006379;IPR000150
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: PS01228
ProDom: PF08282
SMART: 
SUPFAM: 
TIGRFAMs: SSF56784
742592-743462(-)

>nucleotide sequence
TTATTTTTTCTCATCATCAACGATGGCGATCGTTTTTTGAATAATCTCTTTAAATTGATT
GTGCCGTCTTGAACTAGCTATATATGTTGAGATGTCTTTTAATTTTTTATTAGCTCGTTT
CATTGCAAACTTATATGAAGCGATCTCAAACATCGAATAATCATTAAGTGAATCCCCGAT
GACAGCGGTTTGTTCTAAACTAATATTTTCTAAATCACAGATACTTGCTAAAGCAAATGC
TTTATTGATGTTTTTAGTCGTAATCTCTAAAAAAGTCGGGTAAATGTTAGCAATTTCTAA
ATCATCGGGATAGTTTTCAGAAACAAACTGATTAAACTTTTTTAATCGTTTGTGGTTAGA
GCTAATCAAATTAATCTTATAATATCTGCCATCAACAAAATCTTTAGAACAAAAACTCTT
GTTTTTGTTAAAAGAAGCAATTAATCTACCACTAAAATTATCTGATAAGACGATACTACG
ATTAACTTGATCAGTAACTAAATAACCTTGAAAAACGATCTTATTCTTTGTGCAATAATC
AAAGATTGCCTTAGTGGTTAGTGAATCAATACTATGTTCATCTAATTTAATTAATTCAGA
TTGTTCGTTAATTTTAAATAATACTGAACCATTATAAGAGCAAAGATAATTAATCTTTAC
TCCTGCTTCTTGTAATTCATTGACAACCCGTTTAGCGCTTAGATATGATCGTCCAGTGAT
AATTGCAATCACAATATTGGGAAGTTTTTTTCTTAGTTCTAATAATGAACCAATTACTTT
TTTGGTAACTTTTTTACGAATTGATAATAAGGTACCGTCCAGATCAATGCCAATTAGTTT
TAATTGTTTGTTCTTATCTAAGTCACTCAT


>protein sequence
MSDLDKNKQLKLIGIDLDGTLLSIRKKVTKKVIGSLLELRKKLPNIVIAIITGRSYLSAK
RVVNELQEAGVKINYLCSYNGSVLFKINEQSELIKLDEHSIDSLTTKAIFDYCTKNKIVF
QGYLVTDQVNRSIVLSDNFSGRLIASFNKNKSFCSKDFVDGRYYKINLISSNHKRLKKFN
QFVSENYPDDLEIANIYPTFLEITTKNINKAFALASICDLENISLEQTAVIGDSLNDYSM
FEIASYKFAMKRANKKLKDISTYIASSRRHNQFKEIIQKTIAIVDDEKK






















© Fisunov Lab of Proteomics, 2016.