GCW_03230







Uniprot: A0A0F6CL57
Description: putative ribosomal protein
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 8,251
Subunit structure [CC]: 
Gene ontology (GO): integral component of membrane [GO:0016021]; ribosome [GO:0005840]
Gene ontology IDs: GO:0005840; GO:0016021
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the UPF0154 family. {ECO:0000256|SAAS:SAAS00570322}.
Protein families: UPF0154 family
Coiled coil: 
Domain [FT]: 
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: AHB99829
UniPathway: K09976
CDD: 
Gene3D: 
HAMAP: 
InterPro: MF_00363
PANTHER: IPR005359
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: 
ProDom: PF03672
SMART: PD048972
SUPFAM: 
TIGRFAMs: 
777081-777303(-)

>nucleotide sequence
TTATTTTGTTTCCTTAGTATAAGCACGCATCATTTGTTTTACTTGCGCTTCAGAAGGCTT
ACGTCCCATTTGAGCATATAAGCTACGGATCTGTGCTTCTGTAATCGGTGGGTTCTTACG
CATCTGACGCTTGAACACTTTCATTGAGACAAAATAACCAACAAAAGCCCCAACAATTAA
ACATAAAGGAATACTTAAACCTAACGCTAATCCTAATACCAT


>protein sequence
MVLGLALGLSIPLCLIVGAFVGYFVSMKVFKRQMRKNPPITEAQIRSLYAQMGRKPSEAQ
VKQMMRAYTKETK






















© Fisunov Lab of Proteomics, 2016.