GCW_03455
![]() ![]() ![]() |
Uniprot: A0A0F6CL97
Description: 30S ribosomal protein S18 EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: Binds as a heterodimer with protein S6 to the central domain of the 16S rRNA, where it helps stabilize the platform of the 30S subunit. {ECO:0000256|HAMAP-Rule:MF_00270}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): rpsR Gene names (synonym): Mass: 12,196 Subunit structure [CC]: SUBUNIT: Part of the 30S ribosomal subunit. Forms a tight heterodimer with protein S6. {ECO:0000256|HAMAP-Rule:MF_00270}. Gene ontology (GO): ribosome [GO:0005840]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412] Gene ontology IDs: GO:0003735; GO:0005840; GO:0006412; GO:0019843 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ribosomal protein S18P family. {ECO:0000256|HAMAP-Rule:MF_00270, ECO:0000256|RuleBase:RU003910}. Protein families: Ribosomal protein S18P family Coiled coil: Domain [FT]: Motif: Region: EMBL: CP006916 ProteinModelPortal: A0A0F6CL97 MEROPS: EnsemblBacteria KO: AHB99869 UniPathway: K02963 CDD: Gene3D: HAMAP: 4.10.640.10 InterPro: MF_00270 PANTHER: IPR001648 PIRSF: PRINTS: PROSITE: PR00974 Pfam: ProDom: PF01084 SMART: PD002239 SUPFAM: TIGRFAMs: SSF46911 836959-837286(-) >nucleotide sequence GTGTCTTTGGTGTAAGTTACAGTTTCCTGATTGACGTCTTGAAACGATCTTAGCATAAGA GTTTAGGTTCTTTCTTAAAGTGTTAACGTCTTTGTAATCAACTTTTAAGATCCCTTTAGC ACAGAAGTGGCAAAGTTTTCTTGAACGGCTTTTGTAAAAAGTTTTTCTTTTAGCTCCTTC AACAGAAGACTTAGCACTAGCTTTTGCAACTTCTTTCTTGTCGTCGCTACTAATATTATT TGCTGGTTGTTTTGTAATATCACTCAT >protein sequence VNTLRKNLNSYAKIVSRRQSGNCNLHQRHVSNAIKKARIMALLPFVKD |
© Fisunov Lab of Proteomics, 2016.