GCW_03510
![]() ![]() ![]() |
Uniprot: A0A0F6CLA7
Description: 50S ribosomal protein L19 EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: This protein is located at the 30S-50S ribosomal subunit interface and may play a role in the structure and function of the aminoacyl-tRNA binding site. {ECO:0000256|HAMAP-Rule:MF_00402, ECO:0000256|RuleBase:RU000559}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): rplS Gene names (synonym): Mass: 14,001 Subunit structure [CC]: Gene ontology (GO): ribosome [GO:0005840]; structural constituent of ribosome [GO:0003735]; translation [GO:0006412] Gene ontology IDs: GO:0003735; GO:0005840; GO:0006412 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ribosomal protein L19P family. {ECO:0000256|HAMAP-Rule:MF_00402, ECO:0000256|RuleBase:RU000559}. Protein families: Ribosomal protein L19P family Coiled coil: Domain [FT]: Motif: Region: EMBL: CP006916 ProteinModelPortal: A0A0F6CLA7 MEROPS: EnsemblBacteria KO: AHB99879 UniPathway: K02884 CDD: Gene3D: HAMAP: InterPro: MF_00402 PANTHER: IPR001857;IPR018257;IPR008991 PIRSF: PTHR15680 PRINTS: PIRSF002191 PROSITE: PR00061 Pfam: PS01015 ProDom: PF01245 SMART: SUPFAM: TIGRFAMs: SSF50104 846352-846721(-) >nucleotide sequence ATAAGAGATGTACGCTCTTCTAACTTTACCCTTACGTTTAAGTTCGATCTCAATGTTAGG GTTGTGAACGTGGAAGTTCTTTTCAACACCCACTCCACTAGATTCTTTTCGCACGATAAA AGTTTCAGATAATCCTGAACCTTTTCTTCTTAAAACTAAACCATCAAATTTTTGAATTCT GGTTCTTTTTTCATCAGCAATCTTAATTGATACTGAAACTGTGTCACCCACTTGAAAGTT AGGTACAGATTTTTTTAATTGTAGGTTATTAACGTGGTTAATAATATTTTGTTTGTTTAA CTTATTCAT >protein sequence SETFIVRKESSGVGVEKNFHVHNPNIEIELKRKGKVRRAYISYMRERSGKSARIKEKVVN TK |
© Fisunov Lab of Proteomics, 2016.