GCW_03540
![]() ![]() ![]() |
Uniprot: A0A0F6CLB3
Description: 30S ribosomal protein S13 EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: Located at the top of the head of the 30S subunit, it contacts several helices of the 16S rRNA. In the 70S ribosome it contacts the 23S rRNA (bridge B1a) and protein L5 of the 50S subunit (bridge B1b), connecting the 2 subunits; these bridges are implicated in subunit movement. Contacts the tRNAs in the A and P-sites. {ECO:0000256|HAMAP-Rule:MF_01315}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): rpsM Gene names (synonym): Mass: 14,127 Subunit structure [CC]: SUBUNIT: Part of the 30S ribosomal subunit. Forms a loose heterodimer with protein S19. Forms two bridges to the 50S subunit in the 70S ribosome. {ECO:0000256|HAMAP-Rule:MF_01315}. Gene ontology (GO): ribosome [GO:0005840]; rRNA binding [GO:0019843]; structural constituent of ribosome [GO:0003735]; tRNA binding [GO:0000049]; translation [GO:0006412] Gene ontology IDs: GO:0000049; GO:0003735; GO:0005840; GO:0006412; GO:0019843 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ribosomal protein S13P family. {ECO:0000256|HAMAP-Rule:MF_01315, ECO:0000256|RuleBase:RU003830}. Protein families: Ribosomal protein S13P family Coiled coil: Domain [FT]: Motif: Region: EMBL: CP006916 ProteinModelPortal: A0A0F6CLB3 MEROPS: EnsemblBacteria KO: AHB99885 UniPathway: K02952 CDD: Gene3D: HAMAP: 4.10.910.10 InterPro: MF_01315 PANTHER: IPR027437;IPR001892;IPR010979;IPR019980;IPR018269 PIRSF: PRINTS: PIRSF002134 PROSITE: Pfam: PS00646;PS50159 ProDom: PF00416 SMART: SUPFAM: TIGRFAMs: SSF46946 849608-849983(-) >nucleotide sequence GTTTGATTTAGTTCTTTGACCTCTTACAGGTAAGCCTCTTCTGTGACGTAAACCAGCATA TGAACCTACTTCCATTAAACGTTTAATGTTTAATGCAACATCACGTCTTAAGTCACCTTC AAGCACGTAAGTACTAGCAACTGAACGAATTAAAGCTAACTCTTCATCGCTTAAGTCTTT TACTCTTTTGTTGAAGTCAATCTTTGCTTTTCTTAAAATTTCTTGAGCACGAGGTTTACC AATTCCATAAATGTAGGTTAATGAAATTTCAACGCGCTTATTATTTGGGATGTCAATACC TAAAATACGAGCCAT >protein sequence STYVLEGDLRRDVALNIKRLMEVGSYAGLRHRRGLPVRGQRTKSNARTRKGPRKTVANKK IESK |
© Fisunov Lab of Proteomics, 2016.