GCW_03630







Uniprot: A0A0F6CLC9
Description: transcription termination factor NusG
EC number: 
Annotation score: 2 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: FUNCTION: Participates in transcription elongation, termination and antitermination. {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|SAAS:SAAS00565765}.
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): nusG
Gene names (synonym): 
Mass: 30,114
Subunit structure [CC]: 
Gene ontology (GO): DNA-templated transcription, elongation [GO:0006354]; DNA-templated transcription, termination [GO:0006353]; regulation of DNA-templated transcription, elongation [GO:0032784]; transcription antitermination [GO:0031564]
Gene ontology IDs: GO:0006353; GO:0006354; GO:0031564; GO:0032784
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the NusG family. {ECO:0000256|HAMAP-Rule:MF_00948, ECO:0000256|SAAS:SAAS00565689}.
Protein families: NusG family
Coiled coil: 
Domain [FT]: DOMAIN 6 147 NGN. {ECO:0000259|SMART:SM00738}.
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: AHB99901
UniPathway: K02601
CDD: 
Gene3D: 
HAMAP: 2.30.30.30;3.30.70.940
InterPro: MF_00948
PANTHER: IPR006645;IPR014722;IPR001062;IPR010216;IPR008991
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: 
ProDom: PF02357
SMART: 
SUPFAM: SM00738
TIGRFAMs: SSF50104;SSF82679
867025-867829(-)

>nucleotide sequence
TTAAACTGAAAGTTTAAGTTGCTTCTTATTAAGCTTAACGCTTACTAGTTTGCCTAGAAT
CTGAACATCAACAATATATTCGTCGTTATCAATAATTCTAGAGATCTGACCACTAAGACC
TGAGTAATCACCAGAGTTGATATCAACCATATGACCAACTTTTAGTTCGATCGCTTCATC
AACTTGTTCTTTTTCAGTTGACATATCTCCATATTTGTCAGCTGAATCAGATTTTTTCTT
ATGAACGATCGTTTTAGCTGTATTTTCATCAAGAATTAACTCACCACGTTCATTAAACAG
ATTGCGATCCATTTCAATAATCGCATTTGGTGTAATTACAATTCGGTAATTTTGATCAAA
TGATTCCCCATTTAATAGATCTAATTCTTCTGAAGATGAGATCGGGATCGGTTTAGCTCC
CTTACCAGATGAACCTACGATCCCAGTAATGTTCACAGTGTTTCTTACTGCAAATCAAGC
TGCTTCATTCATCTCCATCTTGATGTAGATATAACCTGGGTATTTGTTCGTATCGGTAAT
CTTATATTTCTTATAAACACCATTATCAATCGTAACTCACTTAATGTAAGTGCTATTACG
CATTGTCGACGGTATATTATGGGTCGGGTTATTACTATCAAAGATAGTTTCTTCCACACT
TCGAAACTTAATTACTTTACAATCTAAGATCTGATCTTCAAAGTGAAGTGCTCTAACTTT
AGCTTTTAAGGTTTTAATAACAGAATCTTCATTTCCGTTAGTTGTAGTCGCAATATATCA
TTGCGCGGTAGATTTTTTACTCAT


>protein sequence
MSKKSTAQWYIATTTNGNEDSVIKTLKAKVRALHFEDQILDCKVIKFRSVEETIFDSNNP
THNIPSTMRNSTYIKWVTIDNGVYKKYKITDTNKYPGYIYIKMEMNEAAWFAVRNTVNIT
GIVGSSGKGAKPIPISSSEELDLLNGESFDQNYRIVITPNAIIEMDRNLFNERGELILDE
NTAKTIVHKKKSDSADKYGDMSTEKEQVDEAIELKVGHMVDINSGDYSGLSGQISRIIDN
DEYIVDVQILGKLVSVKLNKKQLKLSV






















© Fisunov Lab of Proteomics, 2016.