GCW_03875







Uniprot: A0A0F6CLQ9
Description: hypothetical protein
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 11,030
Subunit structure [CC]: 
Gene ontology (GO): oxidoreductase activity [GO:0016491]
Gene ontology IDs: GO:0016491
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the aldehyde dehydrogenase family. {ECO:0000256|RuleBase:RU003345}.
Protein families: Aldehyde dehydrogenase family
Coiled coil: 
Domain [FT]: DOMAIN 17 82 Aldedh. {ECO:0000259|Pfam:PF00171}.
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: AHC00032
UniPathway: K00128
CDD: 
Gene3D: 
HAMAP: 3.40.605.10
InterPro: 
PANTHER: IPR016161;IPR029510;IPR016162;IPR015590
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: PS00687
ProDom: PF00171
SMART: 
SUPFAM: 
TIGRFAMs: SSF53720
935817-936114(+)

>nucleotide sequence
ATGGATAATAATAAACATTCTATCGAAGAAATGATGGCGTTAAAATATTATCACATTTTC
TTTACTGGCAACGGTAATGTTGCTAAAAAAGTTATGGAAAAAGCTTCAGCTGATTTGACA
CCAGTAACTTTAGAATTAGGTGGCAAATCCCCATGTATTATTGATAAAGATATCAATCTA
GAAAAAACTGTTAAAAGTTTTTTATTTGGAAAGATGTTAAACGCTGGTCAAACATGTATT
GCCCAGATTATTTGGTTGTTCACAAAGATATATACAATTCTTTTATTAACGAATTAA


>protein sequence
MDNNKHSIEEMMALKYYHIFFTGNGNVAKKVMEKASADLTPVTLELGGKSPCIIDKDINL
EKTVKSFLFGKMLNAGQTCIAQIIWLFTKIYTILLLTN






















© Fisunov Lab of Proteomics, 2016.