GCW_92149







Uniprot: A0A0F6CLZ0
Description: UvrD/REP helicase
EC number: 3.6.4.12
Annotation score: 2 out of 5
Miscellaneous [CC]: 
Protein existence: Inferred from homology
Catalytic activity: CATALYTIC ACTIVITY: ATP + H(2)O = ADP + phosphate. {ECO:0000256|SAAS:SAAS00553768}.
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): uvrD
Gene names (synonym): 
Mass: 88,039
Subunit structure [CC]: 
Gene ontology (GO): ATP binding [GO:0005524]; ATP-dependent DNA helicase activity [GO:0004003]; DNA binding [GO:0003677]
Gene ontology IDs: GO:0003677; GO:0004003; GO:0005524
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Belongs to the helicase family. UvrD subfamily. {ECO:0000256|SAAS:SAAS00597767}.; SIMILARITY: Contains uvrD-like helicase ATP-binding domain. {ECO:0000256|SAAS:SAAS00553567}.
Protein families: Helicase family, UvrD subfamily
Coiled coil: COILED 58 82 {ECO:0000256|SAM:Coils}.
Domain [FT]: DOMAIN 6 301 UvrD-like helicase ATP-binding. {ECO:0000259|PROSITE:PS51198}.; DOMAIN 302 578 UvrD-like helicase C-terminal. {ECO:0000259|PROSITE:PS51217}.
Motif: 
Region: 
EMBL: CP006916
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: AHV85442
UniPathway: K03657
CDD: 
Gene3D: 
HAMAP: 3.40.50.300
InterPro: 
PANTHER: IPR014017;IPR000212;IPR027417;IPR014016
PIRSF: PTHR11070
PRINTS: 
PROSITE: 
Pfam: PS51198;PS51217
ProDom: PF00580;PF13361
SMART: 
SUPFAM: 
TIGRFAMs: SSF52540
503599-505855(-)

>nucleotide sequence
TTACTTTGCATAGGTAATTAGTTTATGGTTTTTAATCAGATCTTTTGTTCCAGCCTTTTT
ATCCTTAAAACTAACTTTGATTGTCAGATCATCAATCTCCCTAACAATCCCTTCACCATA
AAGTTGGTGATAAATAATCTCCCCAACAAAATAATTGTGTTCAACTTCATTAGTTGAATT
CCATGCATCTAACTTAGATGATGATTTCTTCGAATCGAATCAACCATCATCATCTGTTAA
GAAATTATGTTTATCAAAATAAGTTTTAGCTTGATCTTGCTTATCAAGCACTAGATCACT
TAATTCATATAAGAATCTAGAAGGTTGATAAGGTTCTTTAGTCCTAGCATCATAATCTTG
GTTTGAACATAATCAAAGGTTATGTTTGGCTCTAGTGTAAGCAACATAAACAATTCTTCT
TTCTTCTGCTAATTTAGCTTTATTGTTAGTTGCTGCAATTGAACGACTACTAGGTAGAAT
GTTTTCATTCATATTGATGATGAAAACGTTCTTGAATTCTAATCCCTTTGCACTGTGAAT
CGTCATTAATTTTAATGCGTTCTTATTATGGTTTGGTTTATTATTATCAAGATCACCTTC
TAGTGCAAGATTTTGGATAAAGTCATTAATTGTTAATTTGGTGCCAAAATCGTTTTCGTA
TTCTTTTTCGTATTTATTCAAAAAATCAATGAATTCATTGACACTATCATGCTTAGTTGG
TTCGTTAAGATAATCATAATAATTGATTCGTTTAATGATCTCATTGATTGTTTGATAAAC
TGATCAATTACCTTGGTTTGCTCGTAAATCTTCAATCATTTTCTTGAAGTTTTGCGCGCT
TTTTTTAACATTTGCTTTGATATTTGATTCATCTAAATAATCAAGCACTTCGAATTCAGT
GATTGATTTTTTGTTGGCTAGTTCTTTAATTATTTCAATACTTGTATCACCAATCATTCT
TCTAGGTGTATTGATGATTCGATCAAACGCGATATCATCATTAGTATCAACTAATTTAAG
ATAACCAATTAGATCTTTGATCTCTTTTCTTAAAAAGAATTTATACCCACCAAAGATCTC
ATAAGGAATCCGGTTTTCCTTAATTAAGCGTTCTAGTGATACCGAACTAAAATTAGTTCG
GTATAAGATAGCAAAATCACCATAAGTATATTGTTTTGAAGCAACCAGTTCTTTAATCTT
ATCCATTACAAACCGGTTTTGATATTCGATATTACTAAAATTAATTCAAATTGGTTTAGG
CCCTAAATCAGTTAAATCGTGTGATAATAATGATTTAAAATAACGACTATTATTCATCTT
AATTGCGTCGTTTGCCAAATTCAAAATACTTTGTTTTGACCGGTAATTTTGCGTTAAATA
CTTAACAACTAAATCATTAAAATCAAATCTAATTGAATCACCGATCTCACTATTAGCACC
TCTTCAACCATAGATTGATTGATCAGGGTCACCCACAAATAAAAAATTATTATTTTTTTC
TCTTAATAATTTAACGATCTTGTATTGAATTTCATTAGCATCTTGAAATTCGTCTACTAA
AATTGCTTCATAACGGTTTTGCCATTTTTTTAAAATAATTGGATCGTTTAAAAATAGGTT
ATAAGCAATATTTAATAGATCATTAAAATCAATCGCATTAAGCTCTTTTAATGCCTTTTC
ATAATCATGATAGAAATTGCTTAATGGTTGAACTAGATTGGGAGTAAGAATGTGATCTTC
ACCTAGTTTATTTAAATCAGATGCTAAAAATTCAGCTACATCTAAGTTATAAGTTTTTGC
ATCATTAATGATGCTCATCACCTTATTCTTTTTGAAATCAGTATACTGAGAATAATAATA
TTCGTATTTTTGCGATTTTAATAGATCTTCGATCAACTTAGCTTGATCAACTTCATCTAA
GATATTAAACCGATCGTTCAGACGATCAACATTATTAACTTCTTCTCGTAAAACTTGGGC
ACAAAACCCATGAAACGTTCTAAAACTGACTTGAGTTTTTTCTTTATCCAGAAGTTTTTC
AAGTCGGTGTTGCATCTCTTTAGCAGCTTTATTAGTAAATGTAATCGCTAAGATCTTATA
TTCTGGGATCTTGAAATGCTCAATCAAATAAGCAATTCGTGATGTTAAAACCTTTGTCTT
ACCAGTACCAGCACCAGCGACAACAAAAATTGGAATTAAATCACTTGTAACAACATCATA
TTGTTGTTTGTTTAAAGGCTTTAAGTAATCTTGCAT


>protein sequence
MQDYLKPLNKQQYDVVTSDLIPIFVVAGAGTGKTKVLTSRIAYLIEHFKIPEYKILAITF
TNKAAKEMQHRLEKLLDKEKTQVSFRTFHGFCAQVLREEVNNVDRLNDRFNILDEVDQAK
LIEDLLKSQKYEYYYSQYTDFKKNKVMSIINDAKTYNLDVAEFLASDLNKLGEDHILTPN
LVQPLSNFYHDYEKALKELNAIDFNDLLNIAYNLFLNDPIILKKWQNRYEAILVDEFQDA
NEIQYKIVKLLREKNNNFLFVGDPDQSIYGWRGANSEIGDSIRFDFNDLVVKYLTQNYRS
KQSILNLANDAIKMNNSRYFKSLLSHDLTDLGPKPIWINFSNIEYQNRFVMDKIKELVAS
KQYTYGDFAILYRTNFSSVSLERLIKENRIPYEIFGGYKFFLRKEIKDLIGYLKLVDTND
DIAFDRIINTPRRMIGDTSIEIIKELANKKSITEFEVLDYLDESNIKANVKKSAQNFKKM
IEDLRANQGNWSVYQTINEIIKRINYYDYLNEPTKHDSVNEFIDFLNKYEKEYENDFGTK
LTINDFIQNLALEGDLDNNKPNHNKNALKLMTIHSAKGLEFKNVFIINMNENILPSSRSI
AATNNKAKLAEERRIVYVAYTRAKHNLWLCSNQDYDARTKEPYQPSRFLYELSDLVLDKQ
DQAKTYFDKHNFLTDDDGWFDSKKSSSKLDAWNSTNEVEHNYFVGEIIYHQLYGEGIVRE
IDDLTIKVSFKDKKAGTKDLIKNHKLITYAK






















© Fisunov Lab of Proteomics, 2016.