GCW_92263
![]() ![]() ![]() |
Uniprot: A0A0F6CLZ1
Description: segregation and condensation protein B EC number: Annotation score: 2 out of 5 Miscellaneous [CC]: Protein existence: Inferred from homology Catalytic activity: Cofactor: Enzyme regulation: Function [CC]: FUNCTION: Participates in chromosomal partition during cell division. May act via the formation of a condensin-like complex containing Smc and ScpA that pull DNA away from mid-cell into both cell halves. {ECO:0000256|SAAS:SAAS00459874}. Pathway: Active site: Binding site: Calcium binding: DNA binding: Metal binding: Nucleotide binding: Site: Gene names (primary): scpB Gene names (synonym): Mass: 20,931 Subunit structure [CC]: SUBUNIT: Homodimer. Homodimerization may be required to stabilize the binding of ScpA to the Smc head domains. Component of a cohesin-like complex composed of ScpA, ScpB and the Smc homodimer, in which ScpA and ScpB bind to the head domain of Smc. The presence of the three proteins is required for the association of the complex with DNA. {ECO:0000256|SAAS:SAAS00459884}. Gene ontology (GO): cytoplasm [GO:0005737]; cell division [GO:0051301]; chromosome separation [GO:0051304] Gene ontology IDs: GO:0005737; GO:0051301; GO:0051304 Chain: Signal peptide: Domain [CC]: Sequence similarities: SIMILARITY: Belongs to the ScpB family. {ECO:0000256|SAAS:SAAS00570500}. Protein families: ScpB family Coiled coil: Domain [FT]: Motif: Region: EMBL: CP006916 ProteinModelPortal: MEROPS: EnsemblBacteria KO: AHV85443 UniPathway: K06024 CDD: Gene3D: HAMAP: 1.10.10.10 InterPro: PANTHER: IPR005234;IPR011991 PIRSF: PRINTS: PIRSF019345 PROSITE: Pfam: ProDom: PF04079 SMART: SUPFAM: TIGRFAMs: SSF46785 529469-530012(-) >nucleotide sequence ATCAAAATGCTTGATTTGGGGAAGATCATCAATTGATTCAATCCCAAACAGATCAAAGAA TTTTTCTGAAACGTTATATAAGAAAGGACGACCAGGAGTATCAGCACGACCAACTTCAAC GATCAACCCTTTTTCTAATAAGTTATCAACCAAACTTAATGAGTCTACCCCTCTGATCTC ATTAATTCTTACTCTGGTACATGGTTGATTGTAAGCAACTATTGCTAAAACTTCCATTAA ACTCTTGTTTAGTGGGTTTTTAAACCGTTCAGAAACATAGCGTTGCATATCTTTTTTAAC AGCTGCTTTAGTTAAGATCTTATACCGCCCACCATAGTTTTTAATCGTTAAACCAAAGTT CAGGTTCTGATCATAACTGTAGATCATCTCTTCTAACTCTTTAAACAACTGATCTTGATG GATCTTGGGTATGATCTTATTTAATTCTTGAAGCGTCATCCCATTTCTTCCAGCCACATA CAA >protein sequence AVKKDMQRYVSERFKNPLNKSLMEVLAIVAYNQPCTRVRINEIRGVDSLSLVDNLLEKGL IVEVGRADTPGRPFLYNVSEKFFDLFGIESIDDLPQIKHFDPDSYQEGNFFDSNRYDENE |
© Fisunov Lab of Proteomics, 2016.