SPM_001090


  Uniprot: A0A037UQ39
Description: ABC transporter ATP-binding protein
EC number: 
Annotation score: 1 out of 5
Miscellaneous [CC]: 
Protein existence: Predicted
Catalytic activity: 
Cofactor: 
Enzyme regulation: 
Function [CC]: 
Pathway: 
Active site: 
Binding site: 
Calcium binding: 
DNA binding: 
Metal binding: 
Nucleotide binding: 
Site: 
Gene names (primary): 
Gene names (synonym): 
Mass: 25,875
Subunit structure [CC]: 
Gene ontology (GO): ATP binding [GO:0005524]; ATPase activity [GO:0016887]
Gene ontology IDs: GO:0005524; GO:0016887
Chain: 
Signal peptide: 
Domain [CC]: 
Sequence similarities: SIMILARITY: Contains 1 ABC transporter domain. {ECO:0000256|RuleBase:RU363033}.
Protein families: 
Coiled coil: 
Domain [FT]: DOMAIN 5 224 ABC transporter. {ECO:0000259|PROSITE:PS50893}.
Motif: 
Region: 
EMBL: AGBZ02000001
ProteinModelPortal: 
MEROPS: 
EnsemblBacteria KO: KAI92666
UniPathway: 
CDD: 
Gene3D: 
HAMAP: 3.40.50.300
InterPro: 
PANTHER: IPR003593;IPR003439;IPR017871;IPR027417
PIRSF: 
PRINTS: 
PROSITE: 
Pfam: PS00211;PS50893
ProDom: PF00005
SMART: 
SUPFAM: SM00382
TIGRFAMs: SSF52540
194997-195687(-)

>nucleotide sequence
TTATTCATTTTCAAACATCTGCTTTGTATAATTAAGCACACTACCATATTCTTGAAGAAC
ATTAGCTATTGCTACATCCGATTTAATTTTTCCGGCTGATAAATATATAATCCGATCACA
GAAACGTTCAATTTCTTCCATATTATGTGATACGAGCAACATTGCTCGTTGATTAATAAT
AATATTTTGTTCTAAAAATTGAAAAATAGTTTCTTTAACTGCAATATCTAAGCCCGTTGA
AACTTCATCCAAAATTACTAATTGTGGTTGATGGATAACTGATAATAAGATATTTACTCG
CTGTTGCTGACCTCCTGATAATTTAACAATCTTTTTTTTAGCAACTTCTGTTAATTGATA
AGTAATAATTAATTGTTTAATTTCATCCCTCGTTAATGGCAACTGAAAAGCTTTACAATA
ATATTTAATCATATCCATCAATGTTAAACCCGGTGGATATTGTGAATTTTGAAACTGCAT
TCCAATGGTTAAATTTGGTTGATAAATAACTTCACCATTACTAGCTTTTCGCACACCGGC
AAGAATCTCACTTAATGTTGTTTTACCACTTCCATTAGCACCAATTAAACCAATTTTTTC
ATGCTGATGTATTGCTAAACTAACATCTTTTAAAACATATTTTTGTTGGTATTTTTTACT
AATAGCTTTGGCTTCTAAGATAATTGCCAT


>protein sequence
MAIILEAKAISKKYQQKYVLKDVSLAIHQHEKIGLIGANGSGKTTLSEILAGVRKASNGE
VIYQPNLTIGMQFQNSQYPPGLTLMDMIKYYCKAFQLPLTRDEIKQLIITYQLTEVAKKK
IVKLSGGQQQRVNILLSVIHQPQLVILDEVSTGLDIAVKETIFQFLEQNIIINQRAMLLV
SHNMEEIERFCDRIIYLSAGKIKSDVAIANVLQEYGSVLNYTKQMFENE






















© Fisunov Lab of Proteomics, 2016.